KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2492Help
Entry
t2492             CDS       T00121                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00860  Porphyrin and chlorophyll metabolism
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01120  Microbial metabolism in diverse environments
Module
stt_M00121  Heme biosynthesis, glutamate => heme
stt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    t2492 (hemB)
Enzymes [BR:stt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     t2492 (hemB)
Exosome [BR:stt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   t2492 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AAO70080
UniProt: Q8XGH0
Position
2564886..2565860
Genome map
AA seq 324 aa AA seqDB search
MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYKAIDAMPGVMRIPEKQ
LAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKNILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttatccatcgccctcgccgcctgcgcaaatccgctgcgctgcgcgctatg
tttgaagagacaacacttagcctgaacgacctggtgttgccgatctttgttgaagaagaa
ctcgacgattacaaagctattgatgccatgcccggcgtaatgcgtatcccggaaaagcag
ctggcgcgagagattgaacgtatcgcaaatgctggcattcgttccgttatgaccttcggc
atttctcaccatactgatgacaccggcagcgatacctggaaagaagacggcctggtggca
agaatgtcccgcatctgtaagcaaaccgtgccggagatgatcgtcatgtccgacacctgc
ttctgcgaatacacctcgcacggccactgcggcgtgttgtgcgaacacggtgtggataac
gatgcgacgctggccaacctcggcaagcaggccgttatcgcggcggcggctggagcagat
tttattgcgccctccgcggcaatggatggacaagtccaggctatccgccaagcgctggat
gccgccggttttaccgatacggcaataatgtcctactccaccaagttcgcctcttctttc
tacggccccttccgtgaagcagcgggtaccgcgttaaaaggcgaccgcaagacgtatcaa
atgaatccgatgaaccgccgtgaagcgattcgcgaatcactgctcgacgaagcccagggc
gcggattgcttaatggtgaaaccggccggcgcgtatctggacgtgctgcgtgaaattcgc
gaacgcacagagttgccgcttggcgcttaccaggtgagcggtgaatacgccatgattaaa
tttgctgctatggctggcgccatcgatgaagaaaaggtcgtgctggaaagtctgggctcg
attaaacgcgccggcgccgatttgattttcagctacttcgcactggatctggctgagaaa
aatattctgcgttaa

DBGET integrated database retrieval system