KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2969Help
Entry
t2969             CDS       T00121                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    t2969 (bglA)
Enzymes [BR:stt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     t2969 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3057324..3058757
Genome map
AA seq 477 aa AA seqDB search
MRKLTLPKDFLWGGAVAAHQVEGGWNKDGKGPSICDVLTSGAHGVPREITQNVVAGKYYP
NHEAVDFYGHYKEDIRLFAEMGFKCFRTSIAWTRIFPNGDESQPNEAGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQHYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASTLAVKAARRINPQMKVGCML
AMVALYPFSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLE
VLREGTCDYLGFSYYMTNAVKAEGGSGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYSL
CELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGLIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactcaccctgccaaaagattttttatggggcggcgcggttgccgcacaccag
gttgaaggcggctggaataaagacggtaaaggccccagcatctgcgacgtgctaaccagc
ggcgcacacggcgtgccacgcgaaatcacccagaatgtcgttgctggcaaatactatccg
aaccacgaggcggtggatttttacggacattacaaagaagacatccgtcttttcgccgaa
atggggttcaaatgcttccgtacttctattgcctggacgcgtatcttcccgaatggcgac
gaatcccagccaaacgaggccggtctgaaattctacgacgacatgtttgatgagttactc
aaatacaacatcgaaccggtcatcaccctttctcactttgaaatgccattacatctggta
cagcactacggcggctggaccaatcgtaaagtggttgatttctttgtccgttttgctgaa
gtcgtgtttgaacgctacaaacataaggtcaaatactggatgaccttcaacgaaattaac
aaccagcgaaactggcgcgcgccgctgtttggctactgctgttccggcgtggtgtatacc
gagcatgagaatccagaagaaaccatgtatcaggtcttacatcatcagtttgtcgccagc
acgctggcggtaaaagcggcacgtcgtattaatccacagatgaaagttggctgtatgctg
gcgatggtcgcgctgtatcctttctcctgtaaaccagaagatgtgatgtttgctcaggaa
tcgatgcgtgaacgctacgtctttaccgatgtgcagctgcgcggctattacccgtcctat
gtgttgaacgagtgggagcgccgcggatttaacatcaaaatggaagatggcgatcttgaa
gtgctgcgcgaaggcacctgcgattatcttggtttcagttattacatgaccaacgcggtc
aaagccgaaggcggtagcggcgatgcgatttccggttttgaaggcagcgtaccgaacccc
tatgttaaagcatctgactggggctggcagattgacccggtgggtctgcgctattcattg
tgtgaactgtacgaacgctatcaaaagccgctatttattgtcgaaaacggttttggtgct
tacgacaaagtagaagaagatggcagcatcaacgacgactatcgcattgactacctgcgc
gcccatattgaagagatgaaaaaagcggtgacttacgatggtgtcgacctgatgggctac
acgccgtggggctgcatcgactgcgtgtcgttcaccaccggtcagtacagcaagcgctac
ggcttaatctacgtgaacaagcacgatgacggtacgggcgatatgtcgcgttcgcgtaag
aagagcttcaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system