KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3336Help
Entry
t3336             CDS       T00121                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    t3336 (pldB)
Enzymes [BR:stt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     t3336 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3438275..3439291)
Genome map
AA seq 338 aa AA seqDB search
MFQQQNDWETRENAFAAFAMGPLTDFWRQREEAEFIGVDNIPVRFVRFRNDSNDRTIVIC
PGRIESYVKYAELAYDLFHLGFDIFIIDHRGQGRSGRMLSDPHRGHVDHFNDYVEDLAAF
WQQEIEPGSWRKRYILAHSMGGAIATLFLQRHRVRCDAIALTAPMFGIVIRLPSFMVRHI
LDWAEGHQRIREDYAIGTGQWRALPFGMNALTHSRQRYQRNLRFYADEPQLRVGGPTWHW
VREGILAGEQVLAGASDDTTPTLLIQAEEERVVDNRTHDRFCEIRAAAGYPCEGGKPLVI
KGAYHEILFEKDAMRSVALNAIVEFFNKPNLSSGNRFA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaatgactgggaaacaagagaaaatgcgtttgccgcttttgctatg
gggccgctgaccgatttttggcgtcagcgggaagaggcggagtttatcggcgtggataac
attccggtgcgctttgtccgttttcggaatgactccaacgatcggacgatcgtcatttgt
cctggccgcattgagagttatgtaaaatacgctgaactggcgtatgacctttttcatctc
ggttttgatatcttcatcatcgaccaccgtggtcaagggcgctccgggcggatgttatcg
gacccgcatcggggtcatgtcgatcattttaacgattatgttgaggacttagcggcgttc
tggcagcaggaaattgagccggggtcgtggcgtaagcgttatatcctggcgcactcaatg
gggggcgcgatagccaccctgttcctgcaacgccatcgtgtgcggtgcgacgctattgcg
ctcaccgcgccgatgtttggtattgtgatacgcttgccttcctttatggtgcgccatatt
ctcgactgggccgaagggcatcagcgtatccgtgaagattacgctattggtaccggtcag
tggcgggcgttgccgtttgggatgaatgcgctgacccacagccgccagcgttatcagcgc
aacttacgattttatgccgacgagccgcagctgcgcgttggcggccccacctggcattgg
gtacgcgaaggcattctggcgggtgagcaggtactggctggggcgagcgatgacacgacg
cctacgctactgattcaggcggaagaagagcgggtagtggataaccgcacccacgatcgt
ttttgtgaaattcgcgccgcggcgggatacccttgtgaagggggaaaaccgctggttatc
aaaggcgcgtaccatgagatcctttttgaaaaggacgccatgcgctcagtcgcgcttaac
gccattgttgaatttttcaacaagcctaatttatccagcggaaatcgctttgcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system