KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3532Help
Entry
t3532             CDS       T00121                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    t3532 (glpK)
Enzymes [BR:stt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     t3532 (glpK)
Exosome [BR:stt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   t3532 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3635244..3636749
Genome map
AA seq 501 aa AA seqDB search
MTEKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSSTL
VEVLAKADISSDQIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTANICEQLKRDGL
EDYIRDNTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVHV
TDYTNASRTMLFNIHDLDWDDKMLDVLDIPRAMLPQVRKSSEVYGQTNIGGKGGTRIPIA
GIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPSGEVNY
ALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPYA
RGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLMQ
FQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETTERN
YRYSGWKKAVKRAMAWEEHDK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaatatatcgttgcgctcgaccagggtaccaccagctcccgcgcggtcgtt
atggatcatgacgcgaatatcgtcagcgtatcacagcgtgaatttgagcaaatttatcct
aagccaggctgggtagaacacgacccgatggaaatttgggcgtctcaaagctcaacgctg
gtagaagtgctggctaaggccgatatcagttccgatcagattgccgctatcggtatcacc
aaccaacgtgaaaccgcgatcgtctgggaacgtgaaaccggcaaaccgatatacaacgct
attgtctggcagtgccgtcgtaccgccaatatttgcgaacagcttaaacgcgacggcctg
gaagattacatccgcgacaataccggtctggtcgtcgacccgtacttctctggcactaaa
gtgaaatggatccttgaccatgtggaaggttcgcgcgaacgcgcgaagcgtggcgagctg
ctgttcggtacggtggatacctggcttatctggaagatgacgcagggccgcgtccacgtt
acggattacaccaacgcctcacgaaccatgctgttcaacatccatgatttggactgggac
gataaaatgctggacgtgctggatatcccacgcgcgatgctgccccaggtacgtaaatcc
tccgaagtctacggccagaccaatattggcggtaaaggcggtacacgtattcctatcgcc
gggattgccggggatcagcaggccgcgctcttcggccaactgtgcgtaaaggaaggaatg
gcaaagaacacctacggcaccggctgctttatgctgatgaacaccggcgagaaagcggta
aaatcggaaaacggcctgctgaccaccatcgcctgcggcccaagcggcgaagtcaactat
gcgctggaaggtgcggtgtttatggcgggagcgtccattcaatggctgcgtgatgaaatg
aagctcatcagcgacgcattcgactccgaatatttcgccacgaaagtgaaagataccaac
ggtgtctacgtggttccggccttcaccggtctgggcgcgccgtactgggatccgtatgcc
cgcggcgccatttttggcctgacccgcggcgtgaactctaatcacattatccgcgcgacg
ctcgaatccatcgcttaccagacccgcgacgtactggaagcgatgcaggccgactccggt
atccgcctgcacgctctgcgtgtggacggcggcgcagtggccaacaacttcctgatgcag
ttccagtcagatattctcggcacgcgggtggaacgcccggaagtgcgcgaagtgaccgcg
ctgggcgccgcctatctggctggcctggccgtcggttactggcagaacctggacgagctg
caggaaaaagccgtcattgagcgagaattccgccccggcattgaaaccaccgagcgtaac
taccgttacagcggctggaagaaagcggttaaacgcgcaatggcgtgggaagagcacgac
aagtaa

DBGET integrated database retrieval system