KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3557Help
Entry
t3557             CDS       T00121                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00010  Glycolysis / Gluconeogenesis
stt00030  Pentose phosphate pathway
stt00051  Fructose and mannose metabolism
stt00052  Galactose metabolism
stt00680  Methane metabolism
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01120  Microbial metabolism in diverse environments
stt01130  Biosynthesis of antibiotics
stt01200  Carbon metabolism
stt01230  Biosynthesis of amino acids
stt03018  RNA degradation
Module
stt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    t3557 (pfkA)
   00030 Pentose phosphate pathway
    t3557 (pfkA)
   00051 Fructose and mannose metabolism
    t3557 (pfkA)
   00052 Galactose metabolism
    t3557 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    t3557 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    t3557 (pfkA)
Enzymes [BR:stt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     t3557 (pfkA)
Protein phosphatases and associated proteins [BR:stt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     t3557 (pfkA)
Messenger RNA biogenesis [BR:stt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     t3557 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AAO71062
UniProt: P65693
Position
complement(3657807..3658769)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGHGGRCVGIQNEQLVHHDIIDA
IENMKRPFKSDWMECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
atccgcggtgttgtgcgcgcagcgttgacggaagggctggaagtcatgggcatttatgac
ggctatctgggcctgtatgaagatcgtatggttcagcttgaccgttacagcgtatctgac
atgatcaaccgtggcggtactttcctcggttccgcccgtttcccggaattccgtgacgaa
aatattcgcgctgtcgcgatcgaaaacctgaaaaaacgcggtatcgatgcgctggtagtt
attggcggcgacggttcttatatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcggtctgccaggcactatcgataacgacatcaaaggcaccgactacactatcggctac
ttcactgctctcggcactgtagtggaagcgattgaccgtctgcgtgacacctcctcttct
caccagcgtatctctatcgttgaggtgatgggccgttattgcggcgacctgacgttggcg
gcggctattgctggcggctgtgagtttatcgtggtgccggaagttgaatttaatcgcgaa
gatctggtggccgaaatcaaagccgggatcgcgaaagggaaaaaacacgctatcgtcgct
attactgagcatatgtgcgatgttgacgaactggcgcactttattgaaaaagaaacgggc
cgtgaaacgcgtgcgacggtgctcggccacattcagcgcggtggttccccggtaccttac
gatcgcattctggcttcccgtatgggcgcgtatgctattgacctgctgctggaaggccat
ggcggtcgttgtgtcggtatccagaacgagcagcttgttcatcatgacatcatcgatgcg
attgaaaacatgaagcgtccgttcaaaagcgactggatggagtgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system