KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3575Help
Entry
t3575             CDS       T00121                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:stt01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stt00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:stt00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:stt00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:stt00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:stt00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3676049..3677197
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMS
YHLFDEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVML
EIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINVWLPKAVDDGHNLEARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFA
RIAQAMGVETRGMSDEVASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADP
CAPCNPRTASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgttggcactgccaaaaattagcctgcatggcgctggagcgattgccgat
atggtgaacctcgtggcgaataagcaatggggcaaagcgctgatcgttaccgatggtcaa
ctggtaaagctgggcctgctggatagcctgtttagcgcactggatgaacatcaaatgtct
taccacctgtttgatgaggtgttcccaaacccgacagaagagctggtgcagaaaggtttt
gcggcgtatcagagcgcagaatgtgactacattatcgccttcggcggcggcagcccgatc
gataccgcaaaagcggtgaaaattctgaccgccaacccaggtccatctaccgcctactcc
ggcgtcggcaaagtgaaaaacgccggcgtaccgctggtagcgattaacactacggcaggt
accgcggcagagatgaccagcaacgcggtgattatcgactctgcccgtaaggtcaaagag
gtgatcatcgacccgaatatcatcccggatattgccgtggatgacgccagcgtcatgctg
gaaatcccggcgtctgtgaccgccgcaaccggcatggatgccctgacccatgcggtggaa
gcctatgtctccgttggcgcgcatccgctcaccgacgctaacgcgctggaagcgattcgc
ttaatcaatgtgtggctaccgaaagcggttgacgatggtcataacctcgaagcccgtgag
caaatggcattcggccagtacctggcgggtatggcgttcaacagcgccggtttggggctg
gttcacgcgctggcgcaccagccgggcgcaacccacaacctgccgcacggcgtctgcaac
gctatcctgctgccaattgtcgagaactttaaccgtccgaacgccgtcgcgcgttttgcc
cgcatcgcacaggcgatgggcgtggagacgcgcggtatgtctgacgaagtcgcaagtcag
gaagcgattaacgctatccgtacgctgagcaaacgcgtcggcattccagaaggtttcagc
aagctgggcgtcacaaaagaagatatcgaaggctggctggataaagccctcgccgacccg
tgcgcgccgtgtaacccgcgcaccgccagccgcgatgaagttcgcgagctgtacctggag
gcgttatga

DBGET integrated database retrieval system