KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3698Help
Entry
t3698             CDS       T00121                                 

Gene name
yhjA
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
Enzymes [BR:stt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     t3698 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3814219..3815619
Genome map
AA seq 466 aa AA seqDB search
MKKITLYATTVITVGLLCYLGLSGYVWYYDKQRSKKSDVQASVVGENNKILGYFREKGCD
YCHTPSAELPFYSSFPVAKQLMDYDIQLGYKSFNLEAVRAALIADTPVPQSELNKIEWVM
QHQTMPPTRYVALHWAGGVSDKERTDILNWIADQRERNYASADTDPAHRNEPVQPIPRNI
PVDAKKVDLGFRLYHDERLSGDSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNIEQFWDGRAATLQEQAGGPPLNPIEMASKSWDEIISKLDKDPVLKKDFQAVYPQG
FTGENITDAIAEFEKTLITPDSAFDKWLRGDENALTAQQKHGYQLFKENKCATCHGGIIL
GGRSFEPLGLKRDFNFGEITAADIGRMNVTKEVRDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGTDLPQNDIDDIVAFLESLTGVYTPYQPEYAQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaccctctatgcgacaacggttatcaccgttgggctgttatgttattta
ggtttgtccgggtatgtatggtattacgacaaacagcgcagtaaaaaaagcgatgtgcag
gcctcggttgtgggtgaaaataataaaatactgggttatttcagggagaaaggatgtgat
tattgtcatacgccttccgctgaattgcctttttattcctcttttccggtggcaaagcag
ctaatggattacgatatccagctcggctacaagtcgtttaacctggaggcggtacgggcc
gccctgattgcggatacgccggtgccgcaaagcgaactgaataaaattgaatgggttatg
caacatcagactatgccaccaacccgctatgtcgcgctgcactgggcggggggcgtcagc
gataaagagcgtactgacatcctgaactggatagccgatcagcgtgagcgcaactatgcc
agcgccgataccgaccccgcacaccggaatgaacccgttcagcctattccgcgcaatatt
cccgtcgatgcgaaaaaagtcgacttaggtttccgactttatcatgatgaacgtttatcc
ggcgacagcacaatatcctgtgcgcattgtcacgcgttaaatgcgggcggtgtcgatggc
agaaaaacctcaattggcgttggcggtgcggtagggccaataaatgcgccgacggtattc
aactccgtatttaatatcgaacaattttgggatggtcgtgctgcaaccctgcaggagcaa
gcaggcggaccgccgttaaatcctattgaaatggcctctaaatcctgggatgaaattatt
agcaagcttgataaagaccctgtcctgaaaaaagatttccaggcggtttatccgcaagga
tttaccggggaaaatattactgatgcgatcgccgaattcgaaaaaacgttgataacgccg
gattccgcttttgataaatggctacgtggagatgaaaatgcgctgaccgcgcaacagaaa
cacggttatcaattatttaaagaaaataaatgtgcaacctgtcacggcggtatcatttta
ggcgggcgctcttttgaaccattgggattaaagcgagactttaattttggcgaaattacc
gcagcggatattggtcgtatgaacgtcaccaaagaggttcgcgataaattacggcaaaaa
gtcccaggcttacgcaacgtcgcgttaacagcgccttatttccatcggggcgacgtaccg
acgctggatggcgcggtaaaactgatgctgcgttaccaggttggcaccgatctgccgcaa
aacgatattgacgatatcgtcgccttcctggaaagcctgaccggtgtttatacgccatat
caacctgaatatgcgcaatga

DBGET integrated database retrieval system