KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3900Help
Entry
t3900             CDS       T00121                                 

Gene name
yhjM
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    t3900 (yhjM)
Enzymes [BR:stt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     t3900 (yhjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4029535..4030644
Genome map
AA seq 369 aa AA seqDB search
MMTMLRGWITMIVMLTAINAQAACSWPAWEQFKKDYISQQGRVIDPGDARKITTSEGQSY
AMFFALAANDRPAFAQLFNWTQNNLAQGSLREHLPAWLWGQKDPDTWSVLDSNSASDGDI
WMAWSLLEAGRLWKETRYTEVGTALLKRIAREEVVNVPGLGSMLLPGKIGFAEANSWRFN
PSYLPPQLAQYFSRFGAPWSTLRETNLRLLLETSPKGFSPDWVRYESKQGWQLKAEKTLI
SSYDAIRVYLWTGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVVSGNAQGTGPVG
FSAALLPFLQNRGAQAVQRQRVADHFPGSDAYYNYVLTLFGQGWDQHRFRFTVKGELLPD
WGQECVSSR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgactatgctgcgcggatggataacgatgatcgtcatgctgacggcaataaatgcg
caggcagcgtgtagctggcctgcgtgggaacagttcaagaaagattacattagccagcag
ggacgcgttatcgatccgggcgatgcgcgaaaaattaccacctccgaagggcagagctac
gccatgttctttgccctggcggcgaacgatcgaccggcgttcgcgcaactgtttaactgg
acgcaaaacaatctggcgcagggatcgctgcgtgaacatctgcccgcctggctgtgggga
caaaaagatcccgacacctggtcggtgctggacagcaactccgcgtccgacggcgatatc
tggatggcatggtcgctgctggaggccggtcgcctgtggaaagagacgcgttataccgag
gtgggcacggcgttgctaaaacgcatcgcccgcgaagaggtcgtgaatgtgccggggctg
ggctcaatgctgctacctggcaaaatcggctttgccgaggcgaatagctggcgttttaac
ccaagctatctgccgccgcagttggcgcaatactttagccgttttggcgcgccgtggtcg
acgctacgggaaaccaatttgcggcttttgttggaaacctcgccgaaaggtttctcgccg
gactgggtgcgttatgaaagcaagcaaggctggcagttgaaagcggaaaagacgctgatc
agtagctacgatgcgattcgcgtctatttatggacgggaatgatgcatgatggcgatccg
caaaaagcgcgtttactggcgcgatttaaaccgatggcgacgttaacgatgaaaaacggc
gttccaccggagaaagtggatgtcgtcagcgggaatgcgcaagggacggggccggtcggg
ttttccgccgctttactgcctttcctgcaaaatcgcggcgcccaggccgtgcagcgacag
cgggtcgcagaccattttcctggcagcgatgcctattacaactatgtgctgactctcttt
ggacaaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgac
tggggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system