KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3982Help
Entry
t3982             CDS       T00121                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:stt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4122305..4124491
Genome map
AA seq 728 aa AA seqDB search
MSSRIDRDVINALIAGHFADPFSVLGMHQTQAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDARGFFCGVLPRRKNFFRYQLAVTWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKFELLDANGNLRIKADPYAFEAQMRPETASMICGLPEKVTPSEERQKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDEFSLAEFDGTHLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWMERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRIIGEQVPGAVSMAEESTDFSGVTRPPETGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGMLYNHTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDNERSVLIFVRRDKAGNEIIVASNFTPV
PRHDYRFGINQPGRWREILNTDSMHYHGSNTGNGGVVHSDEIESHGRQHSLNLTLPPLAT
IWLMREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcgtatcgatagagacgtgattaatgcgctaattgcaggacattttgcggac
cctttttccgtactcggaatgcaccagacccaagccggactagaagtccgcgccctatta
cctgacgccaccgacgtatgggtgattgaacccaaaaccggacgtaaagtcggcaaactg
gaatgtctcgacgctcgcggttttttctgcggcgttttaccccgacgtaaaaatttcttt
cgctatcagctcgccgtgacctggcacggacagcagaacctcatcgacgatccttaccgt
tttggtccattaatacaggaaatggatgcctggctattgtcggaaggcacccacctgcgt
ccttatgaaacgctgggcgcgcacgccgatacgatggatggcgtcaccggcacccgtttc
tccgtctgggcgcctaatgcccgtcgcgtttcggttgtcgggcaattcaactattgggat
gggcgtcgccacccgatgcgtctgcgcaaagagagcggtatttgggagctgtttatcccc
ggcgcgcataatggacaactgtataaattcgagctgcttgatgcgaacggtaatctgcgc
attaaagccgatccctatgcttttgaggcgcagatgcgtccggaaacggcgtcgatgatt
tgcggactgccggagaaagtgacgccaagcgaagaacgacaaaaagccaatcagtttgat
gcgccgatctcgatttatgaggtgcatttaggttcatggcgccgccatacggataacaat
ttctggctgagctatcgtgagctggcggatcagcttgtgccttacgccaaatggatgggc
tttacgcaccttgaactcttgccggttaacgaacatccgtttgacggcagttggggctac
cagccgaccggcctctacgcgccgacccgccgctttggtacgcgggacgacttccgctat
ttcatcaatgcggcccatgcggcgggccttaacgtcattctcgactgggtgccgggccat
ttcccgtccgatgaatttagcctcgcggagtttgacggcacccacctctatgagcatagc
gacccgcgcgagggctatcaccaggactggaatacgctgatctacaactatggtcgtcgt
gaagtcagtaattatctggtgggtaacgccctgtactggatggagcgttttgggattgat
gcgctgcgtgtcgatgcggtggcctctatgatctaccgcgactacagccgcaaagagggc
gagtggataccgaacgagttcggcggtcgtgaaaacctggaagccattgagtttctgcgt
aataccaaccgcattattggcgagcaggtgcccggcgcggtcagcatggcggaagagtcg
acagacttctctggcgtgacgcgtccaccggaaacgggtgggctggggttctggtacaag
tggaatctgggctggatgcacgacacgctggactacatgaagctggacccggtgtaccgc
cagtatcatcacgacaagctgacctttggtatgttgtacaaccataccgaaaactttgtt
ctgccgctgtcgcacgatgaggtggttcacggcaagaaatccattctcgatcgtatgccg
ggcgatgcgtggcaaaaattcgccaacctgcgcgcctattatggctggatgtgggccttc
cccggcaagaaactgctgtttatggggaatgagtttgcccagggacgcgagtggaaccat
gacgccagcctcgactggcacctgctggaggggggcgataactggcaccacggggttcag
cgtctggtgcgcgatctcaaccacacctatcgccaccataaagcgttgcatgagctggat
ttcgatgcttacggctttgagtggctggtggtcgatgacaatgaacgctcagtactgatt
tttgtacgccgtgataaagccggtaacgagatcatcgtcgccagcaactttacgcccgtt
cctcgccacgactaccgctttggcatcaaccagccgggacgctggcgtgaaattctcaat
actgattcgatgcattatcacggtagcaacaccggcaatggcggtgtggtgcacagcgat
gagatcgaaagccatggccgtcagcactctcttaacctgacgttaccgccgttggcgacg
atctggctgatgcgggagggggaatga

DBGET integrated database retrieval system