KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3993Help
Entry
t3993             CDS       T00121                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    t3993 (malQ)
Enzymes [BR:stt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     t3993 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4141320..4143401
Genome map
AA seq 693 aa AA seqDB search
MENKRLDSAALAAGISPSYINAHGKPQSIGAETKRRLLAAMHGTTTGPQAVVPNVKVYTA
GKKMALPVEGRGEFAWLLTTEEGEHYKGRVTGGKKLNLPATLPEGYHTLTLTQDEQRTHC
RIIVAPPRCYEPQALLEGKKLWGACVQLYTLRSEKNWGIGDFGDLKSMLVDVATRGGAFI
GLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRLSEEAQAWWQMPATQQKLR
QARDAQWVDYATVTALKITALRMAWTRFAARDDAQMAEFRHFIAREGESLYWQAAFDALH
AYQVKEDGQRWGWPAWPEAYQSVESPAVKQFCEAHREEVEFYLWLQWLAWRQFAACWDTC
QSFKLPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPHI
IVARAYEPFIDLLRANMQNCGALRIDHVMSLLRLWWIPYDETADQGAYVHYPVDDLLSIL
ALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLWFENDLEKNFRAPGAYPQQSMA
VASTHDLPTLRGYWECGDLTLGKALGLYPDEVILRGLYEDRERAKQGLLDALHKYGCLPK
RAGHKALLMSMTPTLNRGLQRYIADSNSGLLGLQPEDWLDMADPVNVPGTSDQYKNWRRK
LSASLEAMFADEGVNKLIKDLDKRRKAAAKKKK
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaacgtctcgatagtgccgcgctggcggcggggatcagccccagttacatc
aatgctcatggcaaaccgcagtctattggcgctgaaaccaagagacgtttgctggcggcg
atgcacggcacgacaacaggaccacaggcggtcgtgccgaatgtgaaggtttataccgcg
ggtaaaaaaatggcgttgccggtagaggggcgcggtgagtttgcctggctgctgactacg
gaagagggcgagcattacaaagggcgcgtgacgggcggtaaaaaacttaacctgccggct
acgttgccggagggctaccacaccctgacgttgacccaggatgaacagcgtacgcactgc
cgtattatcgttgccccgccgcgatgctatgagccgcaggcgctgctggaggggaaaaaa
ctgtggggggcctgcgtccagctttatactctgcgttcagaaaaaaactggggtattggc
gatttcggcgatttgaagtcgatgctggtcgacgtggcgacacgcggcggcgcgtttatc
ggcctgaacccgatccacgcgctttatccggcgaatccggagagcgccagtccctacagc
ccctcgtctcgtcgctggctgaacgtgatatatatcgacgtcaacgccgtcgaagatttc
cgcctgagcgaagaggcgcaggcatggtggcaaatgcccgccacacagcaaaagctgcga
caggcgcgcgatgcgcaatgggtggattacgctaccgttaccgcgctgaaaatcacggcg
ctgcggatggcgtggacgcggtttgccgctcgcgacgatgcgcaaatggcggagtttcgt
cactttatcgcccgcgaaggcgaaagcctttactggcaggcggcattcgacgcgctgcat
gcgtatcaggtgaaagaggatgggcagcgctggggctggccagcctggccggaggcgtac
cagtcggtagagtctcccgctgtaaaacaattctgtgaagcgcaccgcgaagaggtggag
ttttatctctggcttcagtggctggcctggcgccaattcgccgcctgctgggatacctgc
cagagttttaaactaccgattggtctgtaccgcgatctggcggttggcgtagcggaaggc
ggcgcggaaacctggtgcgaccgggagctgtactgcctgaaagcatctgtcggcgcgccg
ccggatatcctcggcccgctcggtcagaactgggggctgccgccgatggacccgcatatc
attgtcgcccgggcgtatgagccctttatcgacctgctgcgcgccaatatgcaaaactgc
ggcgcgttgcgcattgaccatgtcatgtcgttgctgcgcctgtggtggataccgtatgac
gaaacagcggatcagggggcttacgtccattatccggtagatgatttgctttctattctg
gcgctggagagccaacgtcaccgctgtatggtgataggcgaagatctggggacggtgcca
gttgagattgtcggcaagctgcgcgatagcggggtctattcttataaagtgctgtggttt
gaaaatgaccttgagaaaaacttccgcgcgccaggcgcatatccgcaacaatcgatggct
gtcgcctcgacgcacgatctccccacgctgcgcggctattgggaatgcggtgacctgacg
ttgggtaaagctctggggctttatccggatgaagtgattctgcgcgggctgtatgaggat
cgcgagcgggcgaaacaggggctattggacgcgctgcataaatatggctgtctgccaaaa
cgcgccgggcataaggcattgttaatgtcgatgacgccaacgctaaatcgcggacttcag
cgctatatcgccgacagtaacagcggtctgttggggcttcagccggaggactggctggat
atggccgatccggttaacgtaccgggcaccagcgatcagtataaaaactggcggcggaaa
ttgtctgcatctcttgaggctatgtttgccgatgagggcgtaaacaagctgattaaggat
ttggataagcgccgaaaagcggccgcgaagaagaagaagtaa

DBGET integrated database retrieval system