KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4111Help
Entry
t4111             CDS       T00121                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00620  Pyruvate metabolism
stt00630  Glyoxylate and dicarboxylate metabolism
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01120  Microbial metabolism in diverse environments
stt01200  Carbon metabolism
Module
stt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    t4111 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    t4111 (aceB)
Enzymes [BR:stt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     t4111 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AAO71575
UniProt: Q83ST3
Position
4249387..4250988
Genome map
AA seq 533 aa AA seqDB search
MNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDN
GKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNEVLGEYKNQLFITRDEDAPITAEQLLEPCEGERTEAGMRA
NIRVAVQYIEAWIPGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALFR
EMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgagctg
gaaaagcaagtcctgaccgctgaggcagtcgagtttttgacggagttagtcacccgtttt
acgccaaaacgcaataaactcctggctgcacgtatccagcaacagcaggatattgataac
ggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcagatt
cgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaacgt
aaaatggtgattaatgccctgaacgcaaatgtgaaagtgtttatggcggattttgaagac
tcgctggcgccggactggaataaagttattgatggtcaaatcaacctgcgtgatgcggtg
aacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgatccg
gccgtattgatttgtcgtgtacgcggtctacatctgccagaaaaacatgttacctggcgg
ggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactacaaa
gcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctggcag
gaggcagcctggtggagtgaagttttcagctacgccgaagaccgcttcaatctaccgcgc
ggtacgatcaaagcgaccctgttgattgaaacgctgcctgctgttttccagatggatgag
attcttcatgcgttgcgtgatcatatcgtcggtctcaactgtggtcgctgggattatatt
ttcagctatatcaaaacgttgaaaaatcacccggatcgcgtcctgccggacaggcaggtg
gtaacgatggacaaaccgtttctgagtgcctactcgcgcctgctgatcaaaacctgtcac
aagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgttgaa
cgcaataatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaacggc
cacgacggcacgtggattgcgcatcccgggttggcggatacggcaatggccgtctttaac
gaggtactgggcgagtacaaaaatcagctgttcattacccgtgatgaagatgcgccgatt
accgctgagcagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgcgcc
aatattcgcgtggcagtgcagtacattgaagcgtggatccccggcaatggctgtgtaccg
atttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctggcag
tggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaagcgcttttccgc
gaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctacagc
agcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacatcagatgactta
atcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system