KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4205Help
Entry
t4205             CDS       T00121                                 

Gene name
melA
Definition
(GenBank) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00052  Galactose metabolism
stt00561  Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    t4205 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    t4205 (melA)
   00600 Sphingolipid metabolism
    t4205 (melA)
Enzymes [BR:stt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     t4205 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: AAO71669
UniProt: Q8Z1P0
Position
4372168..4373520
Genome map
AA seq 450 aa AA seqDB search
MTAPKITFIGAGSTIFVKNILGDVFHREALKSAHVALMDIDETRLEESHIVVRKLMDSAG
ASGRITCHTHQKAALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWQICEDMTEVCPKATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAE
ELARDLNIDPASLRYRCVGINHMAFYLELERKTADGTYVNLYPELLAAYDAGQAPKPNIH
GNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIARYKVPLDEYPKRCVE
QLANWHKELEEYKTAERIDIKPSREYASTIMNALWTGEPSVIYGNVRNEGLIDNLPQGSC
VEVACLVDANGIQPTKVGTIPSHLAAMMQTNINVQTLLTEAILTENRDRVYHAAMMDPHT
AAVLGIEEIYALVDDLIAAHGDWLPAWLRR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacccaaaattacctttatcggcgcaggttctacgattttcgtcaaaaatatc
ctcggcgatgtgtttcaccgcgaggcgctaaagtcagcgcatgtcgccctgatggatatt
gacgaaacccggctggaagagtcgcacattgtggtacggaaactgatggactcagcgggc
gcttctggccggattacctgccatacccaccagaaagcggcgctacaggatgcggatttc
gtggtggtcgcctttcagattggcggctatgaaccctgcaccgtgaccgattttgaggtt
tgtaagcgtcatggcctggaacagacgatcgccgatacgctggggccgggcggcatcatg
cgcgcgctgcgaaccatcccgcatctgtggcagatttgcgaagacatgacggaagtctgt
ccgaaggccaccatgctcaattacgtcaacccgatggcgatgaatacctgggcgatgtat
gcccgctatccgcatatcaaacaggtcggcctgtgccattcggtacagggaacggcggaa
gaactggcgcgcgacttgaatatcgatcccgcctcgctgcgctaccgctgcgtcggcatt
aaccacatggcgttttacctggaactggagcgcaaaacggctgacgggacttatgtcaat
ctctatcctgaattgctggcggcttatgacgccggacaggcgccgaagcccaatattcac
ggcaatgaacgctgccagaacatcgtgcgctatgagatgttcaaaaagttgggctacttc
gtcacggagtcatcagagcattttgccgagtacacgccgtggtttattaaaccgggacgc
gaggatctgattgcgcgctacaaggtgccgctggatgaatatccgaaacgctgcgtagaa
caactggcgaactggcataaagagctggaggagtataaaaccgccgagcgtatcgacatc
aaaccgtcccgcgagtacgccagcaccattatgaacgctctgtggaccggcgagccgagc
gtgatttacggcaatgtgcgtaatgagggactgattgataacctgccgcagggaagctgc
gtcgaggtggcttgtctggtagatgccaacggcattcaaccgacgaaggtggggacgatc
ccttcccatctggcggcaatgatgcagaccaacatcaacgtgcaaacgctgttgaccgaa
gccatcctcacggaaaaccgcgatcgcgtgtatcacgcggcgatgatggaccctcatacc
gcggcggtgctgggtatcgaagaaatctatgcgttggttgacgatctgatcgccgcgcat
ggcgactggcttccggcctggttacgccgttaa

DBGET integrated database retrieval system