KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4511Help
Entry
t4511             CDS       T00121                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00230  Purine metabolism
stt00240  Pyrimidine metabolism
stt01100  Metabolic pathways
stt03030  DNA replication
stt03430  Mismatch repair
stt03440  Homologous recombination
Module
stt_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    t4511 (holC)
   00240 Pyrimidine metabolism
    t4511 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    t4511 (holC)
   03430 Mismatch repair
    t4511 (holC)
   03440 Homologous recombination
    t4511 (holC)
Enzymes [BR:stt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     t4511 (holC)
DNA replication proteins [BR:stt03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     t4511 (holC)
DNA repair and recombination proteins [BR:stt03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     t4511 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AAO71958
UniProt: Q8Z117
Position
complement(4658845..4659327)
Genome map
AA seq 160 aa AA seqDB search
MATHLNPPQEASYMKNATFYLLDNDTTVNGLSAVEQLVCEIAAERWRAGKRVLIACEDEK
QAIRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTSFADFA
TAFTEVVDFVPYEETLKQLARERYKAYRVAGFNLNTATWK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcatttaaatccaccacaagaagcctcatatatgaagaatgcgacgttctat
cttctggacaatgacaccaccgtcaacggtttaagcgccgttgaacaactggtgtgtgaa
attgccgcagaacgttggcgcgctggcaagcgcgtgctgatcgcctgcgaagatgagaag
caggccattcggctggatgaagcgctgtgggcaagaccggcggaaagttttgtcccgcac
aatctggcaggcgaaggcccacgcggcggcgcgccggttgaaatcgcctggccgcaaaaa
cgcaacagcagcccgcgcgatattttaatcagcctgcgtacaagctttgcagattttgcc
accgctttcacagaagtggtagacttcgtcccttacgaagaaactttgaaacaactggcg
cgcgaacgctacaaagcctaccgcgtggctggttttaacctgaatacggcaacctggaaa
taa

DBGET integrated database retrieval system