KEGG   Streptococcus thermophilus JIM 8232: STH8232_0074Help
Entry
STH8232_0074      CDS       T02026                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase ruvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STH8232_0074 (ruvA)
Enzymes [BR:stu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     STH8232_0074 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
60826..61416
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGTLVKITAKHIVIETNGLGYIVTVANPYSFSDQMNQTIQVYLHQVIRDDAHLLF
GFHTEDEKEVFLKLISVSGIGPTTALAIVAVDDNQGLVAAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFAELPAETTNTTANQTAGNQQLDEAMEALLALGYKATELKKVKAFFEDTN
ETAEQYIKSALKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattatatcaagggcaccctagtaaaaatcacagccaaacacattgtcatagaa
acaaatggtctaggatatattgtcactgtggctaatccctacagcttttctgatcaaatg
aatcagactatccaagtgtatcttcatcaagttattagagatgatgcccacctacttttt
ggttttcatactgaagatgagaaagaagtttttcttaagttgatttctgtttctgggata
ggtccgacgactgctctagccatagtggctgtggatgataatcagggacttgttgctgct
attgataatagtgacatcaaatacctgatgaaatttccaaagattggtaaaaagactgct
caacaaatggttcttgatctggcaggaaaatttgcagagttaccagcagaaacgaccaat
actacggcaaatcagactgcaggaaatcaacagttggatgaagctatggaagctttgctt
gctcttgggtacaaagccacagagcttaagaaagtgaaagccttctttgaggataccaat
gaaacggcagagcaatatattaagtccgctcttaaaatgttgatgaagtga

DBGET integrated database retrieval system