KEGG   Streptococcus thermophilus JIM 8232: STH8232_0600Help
Entry
STH8232_0600      CDS       T02026                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (TIM) (triose-phosphate isomerase) (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STH8232_0600 (tpiA)
   01230 Biosynthesis of amino acids
    STH8232_0600 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH8232_0600 (tpiA)
   00051 Fructose and mannose metabolism
    STH8232_0600 (tpiA)
   00562 Inositol phosphate metabolism
    STH8232_0600 (tpiA)
Enzymes [BR:stu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STH8232_0600 (tpiA)
Exosome [BR:stu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STH8232_0600 (tpiA)
  Exosomal proteins of bladder cancer cells
   STH8232_0600 (tpiA)
  Exosomal proteins of melanoma cells
   STH8232_0600 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489447..490205
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSADLVEAGIAVPAVDLTTVIAAAKGSNL
KVAAQNTYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMIPIICCGESLETYEAGKAAEFVGAQVSAALAGLTPEQVASSVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVLYGGSVKPENVAEYMACPDVDGALVGGASLE
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaacccagaagaagca
aaagcatttgttgaagctgtagcgtcaaaattgccttcagctgaccttgttgaagctggt
attgcggttcctgcagttgatttgacaactgttattgctgctgctaaaggttcaaacctt
aaagttgctgcacaaaacacttactttgaaaattcaggtgcttttactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactatgttgttatcggtcactcagaacgtcgt
gactacttccacgaaaccgatgaagacatcaacaaaaaagctaaagcaatctttgctaac
ggtatgattccaatcatctgttgtggtgaatctcttgaaacttacgaagctggtaaagca
gcagaattcgtaggtgctcaagtttcagctgctttagctggattgactcctgagcaagta
gcttcatcagttattgcgtacgaaccaatctgggctatcggtaccggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgtgcgtgatgttgtggcagctgacttcggt
caagaagtcgctgacaaagtacgtgttctatacggtggttcagttaaacctgaaaacgtt
gctgaatacatggcttgtccagatgttgacggagctcttgtaggtggagcatcacttgaa
cctgaaagtttcttggcattgcttgacttcgttaaataa

DBGET integrated database retrieval system