KEGG   Streptococcus thermophilus JIM 8232: STH8232_0641Help
Entry
STH8232_0641      CDS       T02026                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (aspartate transcarbamylase) (ATCase) (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:stu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:stu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
516897..517823
Genome map
AA seq 308 aa AA seqDB search
MAIADGKVSLKHLVTMETLTNEEVLGMIRRGGDFKNGRADFQLDRQYFAANLFFENSTRT
HKSFEVAEKKLGLDVIEFDAGTSSVNKGETLYDTILTMSALGVDICVVRHSEVDYYKQLI
DSRTIQTSIVNGGDGSGQHPSQCLLDLMTIYEEFGTFGNLKICIAGDITHSRVAKSNMRI
LKRLGAQIYFAGPTEWYSSEFDVYGQHVAIDDVIEDLNVLMLLRVQHERHRNDKGFSKEE
YHTLYGLTEERYAKLADQAIIMHPAPVNRDVEIADSLVEAPKARIVTQMQNGVFVRMAII
EAILNGKA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgcagatgggaaagtgtcactaaaacatttggtgactatggaaaccctcacg
aatgaagaggtcttgggcatgattcgtcgaggtggagattttaaaaacggtagagctgat
ttccagctggatcgacagtatttcgctgccaatctcttttttgaaaattcaacacgaaca
cataagtcctttgaagtagctgagaaaaaacttggattggacgtgattgagtttgatgct
gggactagctcagtaaataagggtgaaaccctctatgatacgattttgacgatgtctgct
ttgggtgttgatatctgtgtggttcgccactcggaagtcgattactacaagcagttgatt
gacagtaggactattcagacttctattgttaatggtggtgacggttctgggcaacaccca
agtcagtgtttgcttgatttgatgacaatttatgaagagttcggaacttttggaaatcta
aagatttgtattgcaggcgatattacgcattcgcgtgtagctaagtcaaatatgcgaatt
ctcaagcgtttgggagcacagatttattttgctggccctacagagtggtattcaagtgag
tttgatgtttatggtcagcatgtggccattgacgacgtcattgaggacttgaatgtactc
atgttgcttcgtgttcagcacgaacgtcataggaatgacaaaggattttcaaaagaagag
taccatactctctatggtttgactgaagaacgttatgcaaagttagcagatcaagcaatc
attatgcacccagctccggttaatcgtgatgtggaaattgctgatagcttggttgaggca
cctaaggcacgtatcgttactcagatgcaaaatggagtctttgtccgtatggcgattatc
gaagctattttaaatggcaaagcgtaa

DBGET integrated database retrieval system