KEGG   Streptococcus thermophilus JIM 8232: STH8232_0805Help
Entry
STH8232_0805      CDS       T02026                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:stu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
666121..666717
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFSKFPGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVC
GRLTDDDPCIICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMNGVGPD
DINLKSLITRLMDSEVDEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcctactccaattgctaaactgattgatagtttttcaaaatttccaggaatt
ggggctaagacggcgacacgtctggctttctataccattagcatgtctgatgaagatgtc
aatgattttgcaaaaaatcttttagcagcaaaacgtgagttgacctattgttcagtttgt
ggtcgcttgactgatgatgacccatgtattatttgtacggatgaaactagagaccgtact
aagattttggttgttgaggactccaaagatgtttctgctatggaaaagattcaggaatat
cgtggtctctaccatgtgcttcaagggcttatctcccctatgaatggtgttggaccagat
gatattaatttaaaaagtttgattacccgtcttatggatagcgaggttgacgaggtcatc
atcgcaactaatgcaacggccgatggtgaggcaacctctatgtatatttcacgggtcctc
aaacctgcaggtattaaggtgacccgcctagcgcgtgggctggctgttggttctgacatc
gagtacgctgatgaagtaaccttgctaagagccatcgagaatcgaacagaactgtag

DBGET integrated database retrieval system