KEGG   Streptococcus thermophilus JIM 8232: STH8232_0812Help
Entry
STH8232_0812      CDS       T02026                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:stu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669720..670541
Genome map
AA seq 273 aa AA seqDB search
MPELPEVETVRRGLEKLLLGRTILSLEVKVPKMIKTSYDSFLHDLPGQTIQAMRRRGKYL
IFDFGQLIIISHLRMEGKYLLFTDQVPDNKHFHLFFKLDDGSTLVYQDVRKFGTFDLLDR
KQEEAYFTRKKLGPEPTKKTFKYVPFERALMHSGKSIKPLLLEQKLVAGLGNIYVDEVLW
AAKVHPETPANKLSKAAMKRVHDQTIAILQLGIAKGGSTIRTYRNALGEDGTMQNYLQVY
GKTGQPCPRCASMIVKIKLGGRGTHLCPHCQKR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttacctgaggtagaaacagttagacgaggtttagaaaagctgttactagga
aggactattttgtcacttgaagttaaggtccctaaaatgatcaagacatcatacgatagt
tttttgcatgatttgcctggtcagacgattcaagccatgcgacgtaggggaaagtatctc
atttttgattttggtcagttgataataatttctcacttgcgcatggagggaaaatatctg
ctgttcacagaccaggttcctgacaacaaacattttcacctcttttttaagctagatgat
ggctcaaccctagtttatcaggatgtacgtaagtttgggacttttgatttattggatagg
aaacaagaagaggcctattttacaaggaaaaaacttggccctgagcctaccaagaagacc
tttaaatatgtaccgtttgagagagccttaatgcattctggcaagtctattaagccctta
ctcttggagcagaagttagtggccggtctaggaaatatctacgttgatgaggtgctttgg
gcagccaaggttcatcctgagacaccagcaaataaacttagcaaggcagccatgaaacgg
gttcacgatcaaacgattgccattttacagctggggattgctaagggtggttccactata
aggacctatcgtaacgcccttggtgaggatgggaccatgcagaattatctacaggtttat
ggaaagacaggtcaaccttgtccacgttgcgcaagcatgattgtgaaaatcaagttagga
ggaagaggaacacatttgtgtcctcattgtcaaaaacgatga

DBGET integrated database retrieval system