KEGG   Streptococcus thermophilus JIM 8232: STH8232_1072Help
Entry
STH8232_1072      CDS       T02026                                 

Gene name
adhA
Definition
alcohol dehydrogenase, propanol-preferring (fragment) (EC:1.-.-.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:stu01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stu00010]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:stu00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:stu00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:stu00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900284..900772
Genome map
AA seq 162 aa AA seqDB search
MAIQYAKKVFNARVVAVDINQDKLELAKESGADLVVNGKEVEDVAGYIQEKTGGTHSAVV
TAVSKVAFNQAVDRVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAF
DFDAQGLVVPVVETVPVDTAVKVFDQMEKGKIQGRKVLDFTK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttggctattcaatatgctaagaaggttttcaatgcacgagtagtggctgttgatatcaac
caagataaacttgagttggctaaggaatctggtgctgatttagtggtgaacggtaaagaa
gttgaagatgtagcaggctatatccaagagaaaactggtggtacacacagtgctgttgta
acagctgtttctaaggttgctttcaaccaggctgtcgatagagtacgtgccggtggtacg
gtcgttgccgttgggctcccatctgaatacatggagctctcaattgtcaaaacagttcta
gatggtatccgtgttgttggatctcttgtaggtacgcgtaaagacttagaagaagctttt
gacttcgatgcacaaggcttggtagtaccagttgttgaaaccgttcctgtcgatacagct
gtaaaagtatttgatcaaatggaaaaaggtaaaattcaaggacgtaaggtacttgatttc
actaagtaa

DBGET integrated database retrieval system