KEGG   Streptococcus thermophilus JIM 8232: STH8232_1072Help
Entry
STH8232_1072      CDS       T02026                                 

Gene name
adhA
Definition
alcohol dehydrogenase, propanol-preferring (fragment) (EC:1.-.-.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STH8232_1072 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH8232_1072 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    STH8232_1072 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    STH8232_1072 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STH8232_1072 (adhA)
   00626 Naphthalene degradation
    STH8232_1072 (adhA)
Enzymes [BR:stu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STH8232_1072 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900284..900772
Genome map
AA seq 162 aa AA seqDB search
MAIQYAKKVFNARVVAVDINQDKLELAKESGADLVVNGKEVEDVAGYIQEKTGGTHSAVV
TAVSKVAFNQAVDRVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAF
DFDAQGLVVPVVETVPVDTAVKVFDQMEKGKIQGRKVLDFTK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttggctattcaatatgctaagaaggttttcaatgcacgagtagtggctgttgatatcaac
caagataaacttgagttggctaaggaatctggtgctgatttagtggtgaacggtaaagaa
gttgaagatgtagcaggctatatccaagagaaaactggtggtacacacagtgctgttgta
acagctgtttctaaggttgctttcaaccaggctgtcgatagagtacgtgccggtggtacg
gtcgttgccgttgggctcccatctgaatacatggagctctcaattgtcaaaacagttcta
gatggtatccgtgttgttggatctcttgtaggtacgcgtaaagacttagaagaagctttt
gacttcgatgcacaaggcttggtagtaccagttgttgaaaccgttcctgtcgatacagct
gtaaaagtatttgatcaaatggaaaaaggtaaaattcaaggacgtaaggtacttgatttc
actaagtaa

DBGET integrated database retrieval system