KEGG   Streptococcus thermophilus JIM 8232: STH8232_1072Help
Entry
STH8232_1072      CDS       T02026                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase, propanol-preferring (fragment)
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
stu00010  Glycolysis / Gluconeogenesis
stu00350  Tyrosine metabolism
stu00625  Chloroalkane and chloroalkene degradation
stu00626  Naphthalene degradation
stu01100  Metabolic pathways
stu01110  Biosynthesis of secondary metabolites
stu01120  Microbial metabolism in diverse environments
stu01130  Biosynthesis of antibiotics
stu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH8232_1072 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    STH8232_1072 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    STH8232_1072 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STH8232_1072 (adhA)
   00626 Naphthalene degradation
    STH8232_1072 (adhA)
Enzymes [BR:stu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STH8232_1072 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CCC19773
UniProt: F8LWY6
Position
900284..900772
Genome map
AA seq 162 aa AA seqDB search
MAIQYAKKVFNARVVAVDINQDKLELAKESGADLVVNGKEVEDVAGYIQEKTGGTHSAVV
TAVSKVAFNQAVDRVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAF
DFDAQGLVVPVVETVPVDTAVKVFDQMEKGKIQGRKVLDFTK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttggctattcaatatgctaagaaggttttcaatgcacgagtagtggctgttgatatcaac
caagataaacttgagttggctaaggaatctggtgctgatttagtggtgaacggtaaagaa
gttgaagatgtagcaggctatatccaagagaaaactggtggtacacacagtgctgttgta
acagctgtttctaaggttgctttcaaccaggctgtcgatagagtacgtgccggtggtacg
gtcgttgccgttgggctcccatctgaatacatggagctctcaattgtcaaaacagttcta
gatggtatccgtgttgttggatctcttgtaggtacgcgtaaagacttagaagaagctttt
gacttcgatgcacaaggcttggtagtaccagttgttgaaaccgttcctgtcgatacagct
gtaaaagtatttgatcaaatggaaaaaggtaaaattcaaggacgtaaggtacttgatttc
actaagtaa

DBGET integrated database retrieval system