KEGG   Streptococcus thermophilus JIM 8232: STH8232_1215Help
Entry
STH8232_1215      CDS       T02026                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STH8232_1215 (malQ)
Enzymes [BR:stu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     STH8232_1215 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1016945..1018426)
Genome map
AA seq 493 aa AA seqDB search
MHITSLPGDYGIGSFGQAAYDFVDFLKETKQTYWQILPLTTTSYGDSPYQSFSAIAGNTH
FIDLDFLIRDGFLTEADVEGSDFGSDPEFIDYAKVYEARRPLLEKAVKAILADENEAKKF
ETFKAENANWLADYADFMAIKEYFGNKALQDWDDKKAIKRDEATLEKLRKELTGVITYHQ
VVQYLFFSQWAELKAYANKNGIQIIGDMPIYVSADSVEVWTQPHLFKLDAECKPRYIAGV
PPDNFSPTGQLWGNPIYDWNKHKAENYAWWVFRIQKSFKLFDCLRIDHFKGFSDFWEIPA
GDETAENGKWVPGPGYDLFKVVKEELGDLKIIAEDLGNIDDKTRKLLADCGYPGMKILHF
GFYDTTGNSIYVPHAYTQHSVAYTGTHDNEVTNGWYNNLTQEQRDYTDAYINRRQGEPIT
RALLRTLFATVSNTAIATMQDILDKNENSRKNIPNTVGGNWRWRMLPGEITVDKKEFLTD
ITERYNRGNRGNK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcacatcacttccaggtgactacggaatcggatcttttggtcaagcagcctac
gactttgttgatttcttgaaagaaacaaagcaaacatactggcaaattttgccattgact
actacaagttatggagattcaccttaccaatcattctcagcaatagcgggaaatactcac
tttatcgatttggatttccttattcgtgacggattcctgactgaagcagatgttgaaggt
tctgattttggttcagatccagagtttatcgactacgctaaagtttacgaagcacgacgc
ccacttcttgaaaaagcagtcaaagcaatcttggcagatgaaaacgaagctaagaagttt
gaaactttcaaagctgaaaatgctaactggttggcagattatgctgacttcatggctatc
aaagaatactttggtaacaaagcccttcaagattgggatgataaaaaagcgattaaacgt
gatgaagcaactcttgaaaagcttcgcaaagaacttactggtgttatcacataccatcaa
gttgtgcaatacctcttctttagccaatgggcagagttgaaagcctatgctaataagaac
ggtattcaaattattggtgatatgccaatctacgtttcagctgatagtgtggaagtctgg
actcaaccacaccttttcaaattagatgctgaatgtaagccacgttacattgccggagtt
ccaccagataacttctcaccaacaggacaactttgggggaatccaatttatgattggaat
aaacacaaagcagaaaactatgcttggtgggtcttccgtattcaaaaatcattcaaactt
tttgattgcttgcgtatcgaccacttcaaaggtttctctgatttctgggaaattcctgct
ggagatgaaactgctgaaaatggtaaatgggttccaggacctggttatgacctcttcaaa
gtggttaaagaagagttgggtgatcttaagattattgccgaagaccttggtaatattgat
gataagacacgtaaacttcttgcagactgtggttacccaggaatgaagattcttcacttt
ggtttctatgataccactggtaacagcatttatgttccacacgcatacacacaacactca
gtggcttacactggtacacatgataatgaagttactaatggttggtataataacttgaca
caagagcaacgtgattacactgatgcttatatcaaccgtcgtcaaggtgaaccaatcaca
cgtgcccttcttcgcacactcttcgcaacagtaagtaacacagctattgcgactatgcaa
gatattcttgataaaaatgaaaatagccgtaaaaacatccctaatacagttggaggaaac
tggagatggcgtatgcttccaggtgaaatcaccgttgataagaaagaatttttgactgat
attacagaaagatataatcgaggaaatcgaggaaataaataa

DBGET integrated database retrieval system