KEGG   Streptococcus thermophilus JIM 8232: STH8232_1402Help
Entry
STH8232_1402      CDS       T02026                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:stu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:stu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:stu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:stu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:stu00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:stu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1159708..1160727)
Genome map
AA seq 339 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVLKAISEGIEVFGINRGYAGMVEGDIFKLDAKRVENI
LSRGGTFLQSARYPEFAQLEGQLKGIEQLKKYGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATATEALDKIQDTAFSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEYDINEVVRKVKEGYESGEKSHHIIVLAEGVMGAEEFAAKMKEAGD
TSDLRATNLGHVIRGGSPTARDRVLASWMGAHAVDLLKEGIGGVAVGIHNEQLVESPILG
TAEEGALFSLTEDGKIIVNNPHKARLDFAELNRSLANLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggagatgcccctggtatgaacgctgccgtt
cgtgcagttgttctcaaagcaatttctgaaggaattgaagtgttcggcattaaccgtgga
tacgccggtatggttgaaggagatatcttcaaacttgatgccaaacgcgtagaaaacatc
cttagccgtggtggcactttccttcagtctgctcgctatcccgagtttgcccaacttgaa
ggtcaacttaaaggtattgagcaacttaaaaaatatggaatcgaaggtgtagttgttatt
ggtggagatggttcttaccatggtgctatgcgtttgactgaacatggtttcccagcagtt
ggtctcccaggaactatcgataacgatatcgttggtacagactatacaattggatttgat
acagccgttgcaactgcaacagaagctttggataaaatccaagatacagctttcagtcat
ggacgtacttttgtcgttgaggtaatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcttcaggtgctgaccaaattattgtgccagaagaagaatatgacatcaacgaa
gtggttcgtaaagttaaagaaggttatgaatctggcgaaaaatctcaccacattattgtg
cttgctgagggcgttatgggtgctgaagagtttgcagctaaaatgaaagaagctggagat
acatcagaccttcgtgctacaaatcttggacacgtaattcgtggtggttcaccaactgca
cgtgaccgtgttcttgcttcatggatgggtgcacatgccgttgatcttcttaaagaagga
attggtggtgttgctgtgggtatccataatgaacagcttgttgaaagtccaatccttggt
acagcagaagaaggtgctttgttcagtcttactgaagacggtaaaattatcgtaaacaat
ccacacaaagctcgccttgattttgcagagcttaaccgttctttagctaacttgaaataa

DBGET integrated database retrieval system