KEGG   Streptococcus thermophilus JIM 8232: STH8232_1466Help
Entry
STH8232_1466      CDS       T02026                                 

Gene name
rmlC
Definition
(GenBank) DTDP-4-keto-L-rhamnose reductase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
stu00521  Streptomycin biosynthesis
stu00523  Polyketide sugar unit biosynthesis
stu01130  Biosynthesis of antibiotics
Module
stu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    STH8232_1466 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STH8232_1466 (rmlC)
Enzymes [BR:stu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     STH8232_1466 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CCC20148
UniProt: F8LY11
Position
complement(1212172..1212765)
Genome map
AA seq 197 aa AA seqDB search
MTEQFFGKELAVRKSEAIPGLLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFTEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADEGKVLGAWVDLREGETFGNTYQTVIDASKGIF
VPRGVANGFQVLSDKVAYSYLVNDYWALELKPKYAFVNYADPSLDIEWENLEEAEVSEAD
KNHPFLKDVKPLKSEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaattttttggaaaagaactagctgtacgtaagagtgaagccattccaggc
ttgcttgaatttgatattccagtacatggagacaaccgaggttggtttaaggaaaacttc
caaaaagaaaaaatgttgccacttggttttccagaatcattctttacagaaggaaaattg
caaaacaacgtttctttttcacgtaaaaatgttttgcgtggtttgcacgctgagccttgg
gataaatacatctcagtagcagatgaaggaaaggttcttggagcatgggttgaccttcgt
gaaggcgaaacttttgggaatacttaccaaacagttattgatgcctcaaaaggaatcttt
gttcctcgtggtgttgctaacggtttccaagttttgtctgataaggttgcatacagctat
cttgtgaacgactactgggcacttgaactcaaaccaaaatatgcctttgtcaactacgca
gacccaagccttgatatcgagtgggaaaacttggaggaagcagaagtctcagaagcagat
aaaaatcacccatttctcaaagatgtcaaaccactaaaatcagaagatttgtaa

DBGET integrated database retrieval system