KEGG   Streptococcus thermophilus JIM 8232: STH8232_1479Help
Entry
STH8232_1479      CDS       T02026                                 

Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STH8232_1479
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH8232_1479
Enzymes [BR:stu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     STH8232_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1221377..1222702
Genome map
AA seq 441 aa AA seqDB search
MGILAGKASHFVLSKLGRGSTLPGKIALKFDKDILDTLAKDYEIVVVTGTNGKTLTTALT
VGILKEAYGEIVTNPSGANMITGITSTFLTAKRAKSGKKIAVLEIDEASLPKITEYITPS
LFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPAATILANGDSPLFNSKELVNPVRFYGF
DTEKHAPELTHYNTEGIVCPKCENILQYHLNTYANLGDYVCLNCDFHRPELDYKLTQLTK
ITNTTSEFIIDGQDYKINVGGLYNIYNALAAVSVAEFFGVVPEQIKAGFDKSRAVFGRQE
TFKIGDKSCTLVLIKNPVGASQALDMIKLADHPFSLSVLLNANYADGIDTSWIWDANFES
ILDMDIPEINAGGVRHSEIARRLRVTGYPEDKITQAEKLEDIMTLIEKQDCDHAYILATY
TAMLEFRDILAQRHAVGKGMN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcttggcaggtaaagctagtcactttgttctctcaaaattgggacgtggctca
accctcccaggaaaaatcgcccttaaatttgataaagatattttagacacactagctaaa
gattatgaaatcgtcgttgtcactggtaccaacggtaagactctgacaaccgctttgaca
gtcggtattctaaaagaagcttacggtgaaattgtaactaaccctagtggagccaacatg
atcactgggattacttccacctttctaactgctaaaagagctaaatctggtaagaaaatc
gctgtcttggagattgatgaagccagccttccaaaaatcactgagtatatcactccaagt
ctttttgtcttcacaaatattttccgtgaccaaatggaccgttatggtgaaatttacacc
acttatcagatgattttagatggtgctgctaaggcgccagcggcaactattttggctaac
ggggacagtcctctttttaattctaaagagctagtcaatcccgtacgtttctatggtttt
gacactgaaaaacatgcgccagagcttacacactataatactgaaggaattgtgtgtcct
aagtgcgagaacattcttcagtatcaccttaatacttacgctaacttaggtgactatgtg
tgccttaactgtgactttcaccgtccagaattagattataagctaacgcagctgacaaaa
atcaccaacaccacttctgaatttatcattgacggtcaagattacaagattaacgttggg
gggctctacaacatctataatgcccttgctgccgtttctgtcgctgaattcttcggcgtt
gtgccagagcaaatcaaagctggttttgataagagtcgtgctgtctttggacgtcaagaa
acctttaaaattggtgataaatcatgtactctcgtactgattaagaatccagttggagct
agccaagctctggatatgattaaacttgcagaccatccatttagcttgtcagtccttctt
aatgccaactatgctgatggtattgacaccagctggatttgggatgccaactttgaaagc
attctcgatatggatattcctgaaattaatgctggtggtgtccgtcactctgaaattgcc
cgtcgtctgcgtgtaactggctatccagaggacaaaattacacaagcagaaaaactcgaa
gatattatgaccctgattgaaaagcaagactgcgaccacgcctatatcttagcgacctat
actgccatgcttgaattccgtgatattctggcccaacgtcatgctgtcggaaaggggatg
aactaa

DBGET integrated database retrieval system