KEGG   Streptococcus thermophilus JIM 8232: STH8232_1646Help
Entry
STH8232_1646      CDS       T02026                                 

Gene name
hk08
Definition
sensor histidine kinase (Homolog to HK03 Spn)
Orthology
K11617  
two-component system, NarL family, sensor histidine kinase LiaS [EC:2.7.13.3]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Two-component system
Module
LiaS-LiaR (cell wall stress response) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:stu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1372876..1373886)
Genome map
AA seq 336 aa AA seqDB search
MKKQYLFLILTYSVVVLIGVTLVVMDSFNLNFSLVFGSISQVFHFLFNMFFVVLSLLILL
YILWAIANDNSMRSVNQDLRRIINNQPVKRQGDSELDKNMMRLSHKMRKLTKDLQKTENA
QALKSRDIIKKERGRIARDLHDTVSQELFAASMILSGVSQMVDQLSKEDLHHQIQAVEAL
LTDAQNDMRVLLLHLRPTELENKTLQEGLQMILKELTDKSNIRVVYKDMVKKVPKRIEDN
LFRIAQEFISNTLKHAKASQIEVYLYQNSQEIQLKMLDNGVGFDLNASTDEMRYGLKNIQ
ERVDEMAGTVQFLSAKGKGTSIDVRVPVLRGEDNVE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacagtacctatttttaatcctaacttattcagttgttgttttaattggggtt
acccttgtggttatggatagctttaacctcaacttttcactggttttcggtagtatctct
caggtatttcacttcctttttaacatgttttttgtggttctgagtttgctcattttgctg
tatattctttgggccattgcaaatgataatagtatgcgttcggtcaatcaagacttgcgt
cgtattatcaataaccaacctgtcaaacgtcagggagatagtgagttggacaagaatatg
atgcgtctatctcataaaatgcgtaaattgaccaaggatctgcaaaaaacggaaaatgct
caggctttgaaaagtcgtgatattattaagaaagagcgaggtcgcattgctcgagatctt
cacgataccgttagccaggagctttttgcggctagtatgattctatctggtgtttctcag
atggtggaccagctaagtaaggaagatttacatcatcagattcaggcagtcgaggccttg
ctgactgatgctcaaaatgatatgcgtgtcttgcttttgcaccttcgtccgacagaactt
gagaacaagactttacaggaaggcttgcagatgattcttaaagaattaactgataaatcc
aatatccgtgttgtctataaggatatggttaagaaagtgcctaagcgtattgaagataat
ctctttaggattgcccaagagtttatctctaatacccttaagcacgccaaggccagccaa
atagaggtctacctctatcaaaatagtcaggaaattcagttaaaaatgctagataatggt
gttggttttgatttgaatgcctcgactgacgagatgagatatggactaaaaaatatccaa
gagcgtgttgatgaaatggcgggaactgtgcagttcctatcagctaaaggtaaagggacg
tctattgatgttcgtgtgccagtattaagaggagaagacaatgtcgaataa

DBGET integrated database retrieval system