KEGG   Streptococcus thermophilus JIM 8232: STH8232_1828Help
Entry
STH8232_1828      CDS       T02026                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STH8232_1828 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STH8232_1828 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STH8232_1828 (trpA)
Enzymes [BR:stu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STH8232_1828 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1526104..1526886)
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLQAIKDSKRGIFVPYIMAGDHAKGLDGLFETITLLENSGVSAIEVGIPWSDP
VADGPIIELAGQRSLAKDVTLTAIIKKLQEKKTQVPLVIMTYINPVYQYGIEAFVKDLAE
TSVKGLIIPDLPNEHADFITPYLRDSDIALVPLVSLTTGIDRQKQLIDGAEGFIYAVAIN
GVTGKTGNYRDDLDKHLSNLTAYADIPVLTGFGVSTEEDIKRFNAVSDGVIVGSKIVRDL
HDGKEEEVAEFVTLGSHFEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacactaacaaaacatctacaagctatcaaagacagtaaacgcggtattttc
gtgccctatatcatggctggtgaccacgctaaaggtctagacggactctttgagactatt
actctcttagaaaatagcggtgtttcagctatcgaggtgggtattccatggtctgaccca
gtggctgatggtcccattattgaactagcaggacaacgtagtttggctaaagacgtgact
ttaacagctatcatcaagaagcttcaagaaaaaaagacacaggtgcctttggttatcatg
acctacatcaacccagtttatcagtatggtattgaagcctttgtcaaagatttagcagag
acttctgtcaaggggctcatcattcctgatttgccaaatgaacatgctgactttatcact
ccttatttgagagacagtgacattgctctcgtgcctttggtcagcttgactacaggcatt
gatcgtcagaaacagttgattgatggtgcagaaggctttatctacgccgttgccatcaat
ggtgttactggtaagactggtaattaccgtgatgaccttgataaacacttatctaacttg
actgcctatgcagacattccagttctcacaggttttggtgtgtcaacagaggaagacatt
aaacgctttaatgctgtgtcagacggtgttatcgtgggatcaaaaattgtccgtgacctg
cacgacggtaaggaagaagaagtcgctgaatttgttacattaggttcacattttgaaaaa
tag

DBGET integrated database retrieval system