KEGG   Streptococcus thermophilus JIM 8232: STH8232_1829Help
Entry
STH8232_1829      CDS       T02026                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STH8232_1829
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STH8232_1829
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STH8232_1829
Enzymes [BR:stu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STH8232_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1526890..1528098)
Genome map
AA seq 402 aa AA seqDB search
MTYQQPDAKGFYGKFGGQFVPETLMTAVIELDKAYREAKEDSSFQAELDDLLKNYVGRET
PLYHAKRLTDYIGGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGGKLPDAVMACIGGGS
NAIGMFYPFVNDKSVAMYGAEASGLGLDTEKHAATFAKGRPGILHGALMDVLQDAHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALEGFKLLSRLEGIIPALESSHAI
ALAQKVAAKMSPDQSLIVCLSGRGDKDVMQVKERFEAEAEGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaacaacctgatgcaaaaggattttacggaaaattcggcggtcagttcgtt
cccgaaacgctgatgacagccgttattgaattggataaggcctatcgtgaagccaaagaa
gattcaagtttccaagcggaattggatgacctccttaaaaactatgtgggccgtgaaaca
cctctttaccacgccaaacgtttgacagattatatcggtggagcgcaaatttaccttaaa
cgtgaagatcttaaccacacaggggcccacaagattaacaatgccctcggtcaagtcttg
cttgctaaacgtatgggtaagaagaaaatcatcgccgaaactggtgcaggtcaacacggt
gtcgcaacagcaacagccgctgctcttttcgacatggactgtaccatctatatgggtgag
gaagatgtgaaacgtcaggcgcttaacgttttccgtatggagttgcttggtgccaaagtt
ttcagtgttaccgatggatcacgagtgcttaaggacgctgtaaatgctgctcttcgtgct
tgggttgcaggtatcgaggatactcactacatcatgggatctgcccttggtccagcacca
ttcccagaaattgttcgtgatttccaatctgttatcggtcgtgaagccaaacgccaatat
gcagagatttctggcgggaaactgcctgatgctgtaatggcttgtatcggtggtggttca
aatgctatcggcatgttctacccatttgtcaatgataaatcagtagctatgtatggtgct
gaggcatctggtttgggacttgatactgaaaaacacgccgcaacctttgccaaaggtcgc
ccaggtatccttcatggagcgcttatggatgtcctccaagatgctcatggtcaaataatg
gaagctttctctatctcagctggtctggactacccaggggttggtcctgagcactgttat
ttcaacgaaataggacgtgcgacttacgactctatcacagatgaagaagcgctagaagga
ttcaaacttctgtcacgtttggaaggtattatcccagctcttgagtctagccatgccatt
gcgcttgcacaaaaagtggcagctaagatgtcgccagaccaaagcctcatcgtctgcctc
tcaggtcgtggggataaggacgttatgcaggttaaagaacgttttgaagctgaagcagaa
gggaaataa

DBGET integrated database retrieval system