KEGG   Streptococcus thermophilus JIM 8232: STH8232_1874Help
Entry
STH8232_1874      CDS       T02026                                 

Gene name
ascB
Definition
6-phospho-beta-glucosidase ascB (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH8232_1874 (ascB)
Enzymes [BR:stu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     STH8232_1874 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1565013..1566341)
Genome map
AA seq 442 aa AA seqDB search
MVPIGEDCLSIITGRPKMFDFKDGYFYPAKESIDMYHRYKENIALFGEMGFKTYRLSIAW
SRIFPKGDEAEPNEVGLAFYEDLFKECHKHSIEPLVTITHFDCPMHLITEYGGWRNRKIL
GFYENLCRTLFTRYKGLVKYWLTFNEINMILHAPFMGAGICFEEGENEEQVKYQAAHQDL
VASAMATKLAHEIDPENKVGCMLAAGQYYPNTAHPRDYWAAMQEDRSNYFFIDVQDRGEY
PNYAKKQWERDGIKLEMTEEDLELLKEHTVDFIFFSYYSSRVASGDPEVNEKTAGNIFAP
IKNPYLESSEWGWQIDPLGLRITLNAIWDRYQKPMFIVENGIGAVDTPDENGYVEDDYRI
DYLAAHINTMRDAINEDGVELWGYTTWGCIDLVSAGTGEMKKHYGFIYIDRDNDGKGSLK
SSKKKSFNRYKEVIASNGASVE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggtgccaattggtgaggattgcctttcgattattactggacgtcccaagatgtttgat
tttaaggatggttatttttatccagctaaggaaagcattgatatgtaccaccgttacaag
gaaaatattgctctctttggtgaaatgggctttaagacttatcgactttctattgcttgg
tctcgtatttttcctaagggtgatgaggctgagccaaatgaagttgggctagctttttac
gaggacctattcaaggaatgtcacaaacatagcatcgaacccttagtaactattacgcac
tttgattgtccaatgcacttgattacagagtatggtggatggcgtaatcgtaagattctt
ggtttctatgaaaatctttgccgtacccttttcacacgttataaaggtttggttaagtac
tggctcacttttaacgaaattaacatgattctccatgcaccatttatgggagcagggatc
tgttttgaagagggtgagaatgaggagcaggttaaataccaagcagctcaccaagatttg
gtagcttcagctatggcgactaagttggctcacgagattgatcctgaaaataaggttggt
tgtatgttggcagccggtcagtattatccaaatacagcccacccacgtgactactgggca
gccatgcaagaagatcgtagtaactatttcttcattgatgtccaggatcgtggagagtat
ccaaattatgctaaaaagcagtgggagcgtgatggtattaagcttgagatgactgaagaa
gatttggagcttctcaaagagcatactgttgatttcattttcttctcttattattcaagt
cgtgtggcttcaggtgatccagaagttaatgaaaagactgccggcaatatctttgcccct
attaaaaatccatatttagaatcttcagagtggggttggcaaattgacccactaggcctt
cgtattaccctcaatgctatttgggatcgttaccagaaaccgatgtttatcgttgagaat
gggattggtgctgtggatacaccagatgaaaatggttatgttgaagacgattatcgtatt
gactacttggcagcccacattaataccatgagggatgccatcaatgaagatggtgtagaa
ctttggggatacacaacctggggttgtatcgatcttgtttctgccggaactggtgaaatg
aaaaaacattatggtttcatctatatagaccgcgacaatgatggtaagggtagccttaaa
agctctaagaaaaaatcatttaacaggtacaaagaagttatcgcaagtaacggtgcctct
gtagaatag

DBGET integrated database retrieval system