KEGG   Streptococcus thermophilus JIM 8232: STH8232_2036Help
Entry
STH8232_2036      CDS       T02026                                 

Gene name
recD
Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STH8232_2036 (recD)
Enzymes [BR:stu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     STH8232_2036 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1695686..1698190
Genome map
AA seq 834 aa AA seqDB search
MQEFYFSGTIERIIFENASNFFRILLLEIDETDSDFEDYEIIVTGTMGEVMEGEDYTFWG
QLTNHPKYGKQLQMTRYERSKPSASGLIKYFSSDNFKGIGKKTAERIVEIYGEDPIDKIL
EDPSKLEQIPNLSKVNREAFLAKLKINYGTEQILSKLSSYGLTPKAAAQIFNQYKEESLN
LIEKYPYLLVEEVQGIGFKMADQLAERLGIASDAPERLRAALIHCLLEASMEEGDTYIEA
KSLLERTIILLESSRQIELDPALVAHQLTNIIQEDKVQNIETKIFDNTLYFAEQGIYTHL
TRITKDQPDISAEDKIQASLERVEDELGITYDKVQKDAIIKALQSKVFILTGGPGTGKTT
VINGIIKTYADLHGLDLKKSDLPIILAAPTGRAARRMNELTKLPSATIHRHLGLNGEDDF
KTLDDYLDCDLIIIDEFSMVDTWLANQLFESISDTTQVIIVGDQDQLPSVGPGQVLADLL
QIDDLPKVSLTKIFRQSEDSTIVTLASQIRQGQLPTDFTEKKADRSYFEANANHIPQMVP
KIVSAAIKSGIAAQDVQILAPMYRGQAGINNLNTIMQDLLNPKEKANQFAFNDIFFRKND
KILHLVNDTELNVFNGDIGIITDLIPGKYTESKQDEIYMSFDGNEVIYPRNEWNKITLAY
AMSIHKSQGSEFPVVILPITRQSGRMLQRNLIYTAITRAKSKLVMLGEIAAFDYAVHNEG
AKRNTYLIQRFEQTYTQAVDKSVEKNVKNEGTDAFNQTKTENNRPSETLENKDFSENINP
SQTLINTYSHPVDKSVNKPVQTEENYRLTEENWATIDPMIGLSEDDIAAFFNNN
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaattttatttttcaggaactatcgagcgcatcatttttgaaaatgccagtaat
ttttttcgtatcctactcttagaaattgatgaaactgacagtgattttgaagactatgaa
atcattgttactggaactatgggggaagtcatggagggggaagactataccttctggggt
cagctaaccaatcaccccaaatatggcaaacaactccaaatgactcgctacgagcgttca
aaaccctctgccagtggccttatcaaatatttctccagtgataatttcaaaggaatcggt
aagaaaacggccgagcgtattgtcgagatttatggcgaagaccctattgacaagattctc
gaagaccctagtaaattagagcagattcctaatctgtccaaggtaaaccgagaagccttc
cttgcaaaattaaaaatcaactatggtactgaacaaatcttgtcaaaactttccagctat
ggactcacaccaaaggctgccgcacaaattttcaaccaatataaggaagaatcacttaac
cttatcgaaaaatatccttatctcttggtagaggaagtccagggaattggatttaaaatg
gccgatcaactagccgaacgcctagggattgctagcgatgctcctgagcgtttacgagcc
gccctaattcactgtctgctagaagctagtatggaagaaggggacacctacatcgaagcc
aagtccttgcttgaacggactatcattcttttggaaagttctcgccagattgaacttgac
cctgccttggttgctcaccaattgaccaacatcatccaagaggataaggtgcaaaatata
gagactaaaatttttgataataccctatattttgcagaacagggcatctatacccaccta
actcgtatcacgaaagaccagcctgacatcagtgctgaggacaaaatccaagcaagtctt
gaaagggtggaagatgagcttggtatcacctatgacaaggttcaaaaagatgccattatt
aaagccctacaaagcaaggtcttcatcctgacaggtggtcccggaacaggaaaaaccact
gttattaacggaattattaaaacctatgctgaccttcatggtttagacctcaaaaagtct
gatttacccattattttagcagcgccaacgggacgggctgctcgtcggatgaacgaactg
accaagcttcctagtgccactatccatagacatttggggcttaatggcgaggacgatttc
aagaccttagatgactatcttgattgcgatttgattatcatcgatgagttctctatggtt
gatacttggttggccaatcaactcttcgaaagcatttccgatactactcaagtaatcatt
gtaggtgaccaagatcagctaccttctgtaggccctggccaagtcttagctgaccttttg
cagattgatgacttgcctaaggtttccctaaccaaaattttcagacaatctgaggattcc
actattgttaccttagctagccagatacgccaaggccaactacccactgatttcacagag
aaaaaagctgaccgatcatactttgaggctaatgctaaccatattccacagatggtccct
aaaattgtctctgctgctattaaaagtgggatcgctgctcaggatgtacagattctggcc
cccatgtaccggggacaggctggtatcaacaatctcaataccattatgcaggatctactt
aatcccaaagaaaaagccaatcaatttgcctttaatgatattttcttccgtaagaatgac
aagattctccacctggtcaacgatacagaactcaatgtcttcaatggcgatatcggaatc
attactgatctcatacctggtaaatatactgaaagtaagcaagatgaaatttacatgtcc
ttcgatggcaatgaggttatctatcctcgtaacgaatggaataagattactctggcctat
gccatgtctatacacaaatcccaagggagtgaattcccagtcgttatccttcccatcaca
cgccaaagtgggcgtatgcttcaacgtaacctcatctacaccgctatcacacgcgccaag
agtaaactggtcatgttgggggaaatcgcagccttcgattatgccgttcacaacgagggg
gccaaacgtaatacctacctcatccaacgttttgaacaaacttatacacaagctgttgat
aagtctgtcgaaaagaatgttaaaaacgagggaacagacgccttcaatcaaacaaaaacg
gaaaacaatagaccctcagaaacccttgaaaacaaagacttctcggaaaatatcaatcca
tcccaaactcttattaacacttattcacatcctgtggataagtctgttaacaaacctgtg
caaacagaagaaaactatcgtttaactgaagaaaattgggcaactatcgacccaatgata
ggtctcagcgaagacgatattgcagccttttttaacaacaactag

DBGET integrated database retrieval system