KEGG   Streptococcus thermophilus JIM 8232: STH8232_2116Help
Entry
STH8232_2116      CDS       T02026                                 

Gene name
cap4C
Definition
uTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STH8232_2116 (cap4C)
   00052 Galactose metabolism
    STH8232_2116 (cap4C)
   00500 Starch and sucrose metabolism
    STH8232_2116 (cap4C)
   00520 Amino sugar and nucleotide sugar metabolism
    STH8232_2116 (cap4C)
Enzymes [BR:stu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STH8232_2116 (cap4C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1755542..1756456
Genome map
AA seq 304 aa AA seqDB search
MKNQKVRKAIIPAGGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEQKGKTNLLKLVNDTTSMNLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDITNDKAVPLTKQLINDYEETHASTIAVMPVSSEEVSAYGVIAP
QGKGENGRYSVETFVEKPNPEDAPSNLAIIGRYLLTPEIFGILENQEPGAGNEVQLTDAI
DTLNKTQRVFARVFTGDRYDVGDKFGFMKTSIDYALKHPQIKDDLKQYLIELGHKLEGKP
TKKG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaagttagaaaagctatcatccccgctggaggacttggaacacgcttt
ttaccagctactaaagcattggccaaagaaatgttgccaatcgttgacaaaccaaccatc
caatttatcgttgaagaagctcttaagtctggtattgaagatatcttggttgttaccggt
aaatcaaaacgctctatcgaagaccattttgactcaaacttcgaattagaatataacttg
gaacaaaaaggtaagactaacttgttgaaattggttaatgacaccacttctatgaatctc
cactttatccgtcaaagtcacccacgtggtctcggagatgctgttctccaagccaaagca
tttgtcggaaatgaaccttttgttgtcatgcttggtgacgacctcatggatattactaac
gacaaagcggtacctttgactaaacaacttatcaacgattatgaggagacacatgcatct
actattgcggttatgcctgtgtcttctgaagaagtctctgcttatggtgtaatcgctcct
cagggtaaaggcgaaaatggacgttacagcgttgaaactttcgttgaaaaaccaaatcca
gaagatgcaccgagtaatcttgctatcatcggacgttaccttttaacacctgagattttc
ggtatcttagaaaatcaagaaccaggtgctgggaatgaagtccaattgactgatgctatc
gatactcttaacaaaacacaacgcgtctttgctcgtgtatttacaggagatcgttatgat
gtcggtgacaaatttggctttatgaagacgtctattgattacgcacttaaacaccctcaa
attaaagatgaccttaagcaataccttattgaattgggccacaaacttgaaggcaaaccc
actaaaaaaggctaa

DBGET integrated database retrieval system