KEGG   Streptococcus thermophilus JIM 8232: STH8232_2163Help
Entry
STH8232_2163      CDS       T02026                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STH8232_2163 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STH8232_2163 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STH8232_2163 (thrC)
Enzymes [BR:stu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STH8232_2163 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1798118..1799602)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVTASQAILQGLATDGGLFTPLTTPEVTLDFDHLKDASYQEVAKLVL
SAFLDDFTEEELDYCITNAYDDKFDTAAIAPVVKLQNHYNLELFHGPTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPETEIIVFYPKDGVSKIQELQMT
TQAGANTHVIAIDGNFDDAQTNVKRMFNDVDLREKLLTHHMQFSSANSMNIGRLVPQVVY
YVYAYAQLVKAGHIKNGDKVNFTVPTGNFGNILAAYYAGQIGVPVGKIICASNENNVLTD
FFATGTYDKKRDFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTKELMDALVTKGEYTLA
DADKGILDLFAAGFATEDETAAEIKRVYEEDKYIEDPHTAVASAVYEAYVQKTDDHTPTV
IASTASPYKFPRVAVSAVTGKDSGDDFKAVEDLHQLSGVDIPAAVDGLERAEVRHKTVVA
AADMQKAVESYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtataccaatcaacacgtgacgaaaacaataaagtaacagctagtcaggct
attcttcaaggattggcaacagatggtggcttgttcactccactgacaacacctgaagtt
actttagactttgatcacttgaaagatgcttcttaccaagaagttgctaaattagttttg
tctgctttcttggatgattttactgaagaagaattggattactgtatcacaaatgcttat
gatgataagtttgatacagctgccattgctccagtggtcaaacttcaaaaccattacaac
cttgagctttttcatggtcctaccattgctttcaaagatatggcgctttcaatattgccc
tatttgctaacaacatcagctaagaaacaaggtgttgataacaagattgttattttgaca
gcgacatcaggggatactggtaaagctgccatggctggttttgcagatgtccctgaaact
gaaattattgtcttttatccaaaagatggcgtttcaaaaatccaagaattgcaaatgaca
actcaagcaggtgctaatactcatgttattgcaattgatggtaactttgatgatgcccaa
acaaatgtgaaacgtatgtttaacgatgttgatttgcgtgagaaattgttgactcatcat
atgcaattctcatcagctaactcaatgaacattggtcgtttggtaccacaagtggtttac
tatgtgtatgcctatgcgcagttggtgaaggcaggtcatatcaaaaatggggataaggtt
aacttcacagtaccaacaggaaactttggtaacatcttggcggcttactatgcaggtcaa
attggtgttccagttggtaaaataatctgtgcttctaacgaaaataatgtccttacagac
ttctttgcaacaggtacttatgacaagaaacgtgacttcaaggtaacgacaagtccttct
atggacattttggtatcttctaacctagaacgcttgattttccatctccttggtaatgat
gcggttaagactaaagagcttatggatgcgcttgtgactaaaggtgagtacactttggct
gatgcagataaaggtatccttgatttgtttgcagcgggatttgcaactgaggatgaaaca
gctgctgaaatcaaacgtgtttatgaagaagacaagtatattgaagatcctcacacagcg
gttgcttcagctgtttacgaagcatacgttcaaaagacagatgatcacacaccaacagtt
atcgcttcaacagctagtccatacaagttcccacgtgtagcggtttcagctgttactggt
aaagatagtggtgatgacttcaaggcggtagaagacttgcaccaactttcaggagtagat
atcccagctgctgtagatggacttgaacgtgcagaagttcgccataaaacagttgttgct
gcagctgatatgcagaaagcagttgagagctatcttggtgtataa

DBGET integrated database retrieval system