KEGG   Streptococcus thermophilus JIM 8232: STH8232_2168Help
Entry
STH8232_2168      CDS       T02026                                 

Definition
hypothetical protein
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STH8232_2168
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH8232_2168
   00620 Pyruvate metabolism
    STH8232_2168
   00650 Butanoate metabolism
    STH8232_2168
  Lipid metabolism
   00071 Fatty acid degradation
    STH8232_2168
  Amino acid metabolism
   00350 Tyrosine metabolism
    STH8232_2168
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STH8232_2168
   00626 Naphthalene degradation
    STH8232_2168
Enzymes [BR:stu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STH8232_2168
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     STH8232_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1801251..1802078)
Genome map
AA seq 275 aa AA seqDB search
MISSFQKLFDNGMICSSEQAAIVDAAIYDEVKAEFEAHQCVIISKKADIAKLEKVVLNEA
RIAVNGAIVSHSAIEIAEKAGLKVPEETKMLLAEIPDATMEHPLALEKLSPVLALIKSDG
VEDGFKKAEGMLNLGGIGHTAVIHTENEELQLQYGIRMKACRVLVNSPSAEGGIGNIYNN
MIPSLTLGCGSHGHNSISHNVSSFDLLNVKTLSKRRNNMQWFRVPTKIFFEKDSITYLHH
IEADRVMLVCDPGMVQFGYADLVKRNWNLTAIDQQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatatcatcgtttcaaaaactttttgacaatggtatgatttgttcttctgaacaagca
gctatcgttgacgcagctatttatgatgaagttaaggctgaatttgaagcacatcaatgt
gtcattatttctaaaaaagctgatattgctaaattggaaaaagtagttcttaatgaagca
cgtatagctgtaaacggcgctattgtaagtcactcagctatcgaaattgctgaaaaagct
ggtcttaaagtacctgaagaaacaaaaatgcttttggcagaaattccagatgcaacaatg
gaacacccacttgccttggaaaaattgtctccagtacttgcccttatcaaatctgatggc
gttgaagatggattcaaaaaagcagaaggcatgctcaatttgggaggtattggacataca
gctgttattcacactgaaaatgaagagctccaactccaatacggtatccgtatgaaagct
tgccgtgtcttggtgaatagtccatcggctgaaggtggcattggtaatatctataacaac
atgattccatcattaactcttggttgtggttcacatggtcataactcaatttcacacaat
gttagctcatttgatctcttgaatgtcaagacattgtcaaagcgtcgcaataacatgcaa
tggtttcgtgtcccaacaaaaatcttcttcgaaaaagattcaataacttacttgcatcac
attgaagctgaccgggtgatgttggtttgtgaccctggtatggttcagtttggttacgct
gacttggttaaacgcaattggaacttaaccgccatagaccagcagtag

DBGET integrated database retrieval system