KEGG   Streptococcus thermophilus JIM 8232: STH8232_2171Help
Entry
STH8232_2171      CDS       T02026                                 

Definition
(GenBank) hypothetical protein
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
stu00010  Glycolysis / Gluconeogenesis
stu00350  Tyrosine metabolism
stu00620  Pyruvate metabolism
stu00625  Chloroalkane and chloroalkene degradation
stu00626  Naphthalene degradation
stu00650  Butanoate metabolism
stu01100  Metabolic pathways
stu01110  Biosynthesis of secondary metabolites
stu01120  Microbial metabolism in diverse environments
stu01130  Biosynthesis of antibiotics
stu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH8232_2171
   00620 Pyruvate metabolism
    STH8232_2171
   00650 Butanoate metabolism
    STH8232_2171
  Lipid metabolism
   00071 Fatty acid degradation
    STH8232_2171
  Amino acid metabolism
   00350 Tyrosine metabolism
    STH8232_2171
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STH8232_2171
   00626 Naphthalene degradation
    STH8232_2171
Enzymes [BR:stu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STH8232_2171
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     STH8232_2171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCC20810
UniProt: F8LTS8
Position
complement(1802388..1802783)
Genome map
AA seq 131 aa AA seqDB search
MTKQTKDVQTVIDELATKGVEALDAMANFTQEQVDHIVHQAAIAALDKHMYLAKLAVDET
GRGIYEDKAIKNMYASEYIWNSIEYDKPVGVIAEDKEQGLVSIAEPVGVICGVTPTTNPT
STTIFKALIAL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaaactaaagatgttcaaacagtaatagatgaattggcaacaaaaggtgtt
gaagccctcgatgccatggctaactttacgcaggagcaagtggaccacattgttcaccaa
gctgcgattgctgctctagataaacatatgtatttggcaaaattggctgttgatgaaaca
ggccgtggtatttatgaagataaagccatcaaaaacatgtatgcttctgaatacatttgg
aatagtattgaatatgacaagccagtaggcgttatcgctgaagataaagaacaaggtttg
gtttctatcgctgagccagtaggcgttatctgtggggtgacaccaacaactaacccaacc
tcaacaacgattttcaaagcccttatcgctctttag

DBGET integrated database retrieval system