KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0502Help
Entry
Y1U_C0502         CDS       T02116                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Y1U_C0502
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Y1U_C0502
Enzymes [BR:stw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Y1U_C0502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493909..494835
Genome map
AA seq 308 aa AA seqDB search
MAIADGKVSLKHLVTMETLTNEEVLGMIRRGGDFKNGRADFQLDRQYFAANLFFENSTRT
HKSFEVAEKKLGLDVIEFDAGTSSVNKGETLYDTILTMSALGVDICVVRHSEVDYYKQLI
DSRTIQTSIVNGGDGSGQHPSQCLLDLMTIYEEFGTFGNLKICIAGDITHSRVAKSNMRI
LKRLGAQIYFAGPTEWYSSEFDVYGQHVAIDDVIEDLNVLMLLRVQHERHRNDKGFSKEE
YHTLYGLTEERYAKLADQAIIMHPAPVNRDVEIADSLVEAPKARIVTQMQNGVFVRMAII
EAILNGKA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgcagatgggaaagtgtcactaaaacatttggtgactatggaaaccctcacg
aatgaagaggtcttgggcatgattcgtcgaggtggagattttaaaaacggtagagctgat
ttccagctggatcgacagtatttcgctgccaatctcttttttgaaaattcaacacgaaca
cataagtcctttgaagtagctgagaaaaaacttggattggacgtgattgagtttgatgct
gggactagctcagtaaataagggtgaaaccctctatgatacgattttgacgatgtctgct
ttgggtgttgatatctgtgtggttcgccactcggaagtcgattactacaagcagttgatt
gacagtaggactattcagacttctattgttaatggtggtgacggttctgggcaacaccca
agtcagtgtttgcttgatttgatgacaatttatgaagagttcggaacttttggaaatcta
aagatttgtattgcaggcgatattacgcattcgcgtgtagctaagtcaaatatgcgaatt
ctcaagcgtttgggagcacagatttattttgctggccctacagagtggtattcaagtgag
tttgatgtttatggtcagcatgtggccattgacgacgtcattgaggacttgaatgtactc
atgttgcttcgtgttcagcacgaacgtcataggaatgacaaaggattttcaaaagaagag
taccatactctctatggtttgactgaagaacgttatgcaaagttagcagatcaagcaatc
attatgcacccagctccggttaatcgtgatgtggaaattgctgatagcttggttgaggca
cctaaggcacgtatcgttactcagatgcaaaatggagtctttgtccgtatggcgattatc
gaagctattttaaatggcaaagcgtaa

DBGET integrated database retrieval system