KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0591Help
Entry
Y1U_C0591         CDS       T02116                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:stw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
583956..584552
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFSKFPGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVC
GRLTDDDPCIICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMNGVGPD
DINLKSLITRLMDSEVDEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcctactccaattgctaaactgattgatagtttttcaaaatttccaggaatt
ggggctaagacggcgacacgtctggctttctataccattagcatgtctgatgaagatgtc
aatgattttgcaaaaaatcttttagcagcaaaacgtgagttgacctattgttcagtttgt
ggtcgcttgactgatgatgacccatgtattatttgtacggatgaaactagagaccgtact
aagattttggttgttgaggactccaaagatgtttctgctatggaaaagattcaggaatat
cgtggtctctaccatgtgcttcaagggcttatctcccctatgaatggtgttggaccagat
gatattaatttaaaaagtttgattacccgtcttatggatagcgaggttgacgaggtcatc
atcgcaactaatgcaacggccgatggtgaggcaacctctatgtatatttcacgggtcctc
aaacctgcaggtattaaggtgacccgcctagcgcgtgggctggctgttggttctgacatc
gagtacgctgatgaagtaaccttgctaagagccatcgagaatcgaacagaactgtag

DBGET integrated database retrieval system