KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0695Help
Entry
Y1U_C0695         CDS       T02116                                 

Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
stw00010  Glycolysis / Gluconeogenesis
stw00052  Galactose metabolism
stw00500  Starch and sucrose metabolism
stw00520  Amino sugar and nucleotide sugar metabolism
stw00521  Streptomycin biosynthesis
stw01100  Metabolic pathways
stw01110  Biosynthesis of secondary metabolites
stw01120  Microbial metabolism in diverse environments
stw01130  Biosynthesis of antibiotics
stw01200  Carbon metabolism
Module
stw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C0695
   00052 Galactose metabolism
    Y1U_C0695
   00500 Starch and sucrose metabolism
    Y1U_C0695
   00520 Amino sugar and nucleotide sugar metabolism
    Y1U_C0695
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Y1U_C0695
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Y1U_C0695
Enzymes [BR:stw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Y1U_C0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AFJ83144
Position
684717..685685
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTVKFGILTADGEVQEKWAIETNTFENGSHIVPDIVESLKHRLELYGL
TAEDFIGIGMGSPGAVDRENKTVTGAFNLNWAETQEVGSVIEKELGIPFAIDNDANVAAL
GERWVGAGANNRNVVFITLGTGVGGGVIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NKGCLETVASATGIVRVAHHLAEKYEGNSSIKAAVDNGEFVTSKDIIVAATEGDKFADSI
VDKVSKYLGLATANISNILNPDSVVIGGGVSAAGEFLRSRVEGYFTRYAFPQVRRTTKVK
LAELGNDAGIIGAASLAYSIDK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaactcttaggtattgaccttggtggaacaactgttaagtttggtattttg
actgcagatggtgaagttcaagaaaaatgggctattgaaacaaatacgtttgaaaatggt
agccacattgttcctgacattgtagaatctttgaaacaccgtttggaattgtatggactt
actgctgaagattttattggaattggtatgggatctccaggtgcagttgaccgagaaaat
aaaacagtaacgggtgcctttaacttgaactgggcagaaactcaagaagttggctctgtt
attgaaaaagaacttggtattccattcgctattgataatgatgctaatgtggctgcactg
ggtgaacgttgggttggtgctggtgctaacaatcggaatgttgtctttataacattgggt
acaggtgttggtggcggtgttatcgctgatggtaacttaattcatggtgttgccggtgct
ggtggggaaattggtcacattattgttgaacctgacacaggatttgagtgtacttgcgga
aacaaggggtgtctggaaactgtagcttcagcaacaggtattgtacgtgtagcacatcat
ttggcagaaaaatacgaaggaaactcttctattaaagctgctgtagacaatggtgagttt
gtgacaagtaaagatattatcgtagctgctactgaaggtgataagtttgctgacagcatt
gttgataaagtctctaaatacctcggacttgcaacagcaaacatctcaaacattcttaac
ccagattctgtcgttatcggtggtggtgtttctgccgcaggagaattcttgcgtagtcgt
gttgaaggatactttacacgttatgcattcccacaagttcgccgtacaacaaaagtgaaa
ttagcggagcttggaaatgatgcaggaatcattggagctgctagtcttgcttatagtatt
gacaaataa

DBGET integrated database retrieval system