KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0763Help
Entry
Y1U_C0763         CDS       T02116                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Y1U_C0763
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Y1U_C0763
Enzymes [BR:stw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Y1U_C0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
750704..751975
Genome map
AA seq 423 aa AA seqDB search
MDKIIVKGGNTRLSGEVVIEGAKNAVLPLLAATILASEGQTTLTNVPILSDVYTMNNVVR
GLDIAVDFDEENNTVVVDASGDILDQAPYEYVSKMRASIVVLGPILARIGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGAKITQVGGDITATAEKLKGATIYMDFPSVGATQNLMMAATLA
DGVTTIENAAREPEIVDLAILLNEMGANVKGAGTEKLVIKGVKSLHGTQHAVIQDRIEAG
TFMVAAAMTSGNVLIKDAIWEHNRPLISKLLEMGVDVKEEDRGIRVKSDVSKLKPVAVKT
LPHPGFPTDMQAQFTALMAVVKGKSSISETVFENRFQHLEEMRRMGLHSEILRDTAMIHG
GLPLQGARVMSTDLRASAALILTGMVAEGTTTVGKLTHLDRGYYKFHEKLAKLGAQISRV
SEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattgtgaagggtggcaatactcgattaagtggtgaggttgtcattgaa
ggtgctaaaaacgctgttcttccgttgttagcggcaactattttggcctcggaaggtcag
acaaccttgactaatgttccaatcttgtcagatgtttacaccatgaataatgtggttcgt
ggcttggatattgcagtagactttgacgaagaaaataatactgttgtagttgatgctagt
ggagatattttagatcaggcaccatatgagtatgtcagcaagatgcgtgcatctatcgta
gtacttggtcctattcttgctcgtattggtcatgctaaggtctcaatgcctggcggttgt
acgattggtagtcgtcctattgacctccaccttaaaggtttggaagctatgggtgctaaa
attacccaagttggtggtgatatcaccgcgacagcagaaaaacttaaaggtgcaactatt
tatatggacttcccatcagttggtgctactcagaaccttatgatggcagccactttagct
gatggagtcactaccattgaaaatgctgcgcgtgaaccggaaatcgttgacttggctatt
cttcttaacgagatgggagcaaatgtcaaaggtgctggaactgaaaaactcgtgattaaa
ggtgttaaatctcttcatggtacgcaacatgcggttattcaggaccgtattgaagcaggt
acttttatggtagcagcagccatgacttctggcaatgttcttattaaagatgctatctgg
gaacataaccgtcctttgatttctaaattattggaaatgggtgtcgacgttaaggaagag
gacagaggcattcgtgttaaatctgatgtttcgaaattgaaacctgtagctgttaaaacc
ctacctcacccaggttttccaactgacatgcaggctcaatttacggctcttatggcagtt
gtgaaaggtaaatcaagcataagtgaaacagtcttcgagaatcgtttccaacatttagag
gaaatgcgtcgtatggggcttcattctgaaatccttcgtgatactgcaatgattcacggt
ggtttgccacttcaaggagcgcgagttatgtctactgaccttcgagcttctgcagccctt
atcctcacagggatggttgctgaaggaacaacaactgttgggaaattgacacacttggat
cgtggttactataaattccatgagaaactagctaaactaggagcccaaatttcacgtgta
agtgaggcatag

DBGET integrated database retrieval system