KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0857Help
Entry
Y1U_C0857         CDS       T02116                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stw00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
828727..828915
Genome map
AA seq 62 aa AA seqDB search
MKPLTTEEATPANLNLEGIDFYHRYKEDIALFEELGFKVFRISIAWSRIFPNGDDAEPNE
AG
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcctttgactactgaagaagcaacaccagctaatctaaatcttgaaggtatagat
ttctatcaccgctataaagaggatattgcgctatttgaagagctgggcttcaaggtcttt
cgcatatcgattgcttggtctcgtattttcccgaacggtgatgatgctgagccaaatgaa
gcagggtag

DBGET integrated database retrieval system