KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0858Help
Entry
Y1U_C0858         CDS       T02116                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
stw00010  Glycolysis / Gluconeogenesis
stw00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C0858
   00500 Starch and sucrose metabolism
    Y1U_C0858
Enzymes [BR:stw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Y1U_C0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: AFJ83307
Position
828942..829478
Genome map
AA seq 178 aa AA seqDB search
MAKYNIEPLVTLSHYETPLNLAREYNGWTNRKIIGFYENYVRTVFKHYKDKVKYWLTFNE
VNSVLHAPFMSGGMGTPMEGLSKQELYQAVHHELVGSASITKIGHEIKPEFKIGCMVLAM
PAYGMTATPLDQLAVPEFENQNYLFSDIHARGKYPNYIKYYFKDNGIEIQFPLATMKS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
ttggctaagtataatatcgaacctctggtcaccttgtctcactatgaaacgccactaaac
ttggcacgtgagtacaacggatggactaatcgtaaaataattggattttatgagaattat
gttcgtacagtctttaaacactataaagataaggtcaaatattggttgacctttaatgaa
gtgaactctgttctacatgcaccgtttatgtcaggtggtatgggaactcctatggaaggg
ctatctaaacaagaactctaccaagctgttcaccacgagttggtcggttcagcttcaata
actaagattggccatgaaattaagcctgagtttaaaatcggttgtatggttcttgccatg
cctgcgtacgggatgacagctactccattggatcagttggcagttcctgagtttgaaaat
caaaactatctcttctctgatattcatgcacgtggaaaatatccgaactatattaaatat
tacttcaaagataatggtattgaaatacaatttcccctggcaacgatgaaatcttaa

DBGET integrated database retrieval system