KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0859Help
Entry
Y1U_C0859         CDS       T02116                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C0859
Enzymes [BR:stw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Y1U_C0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829514..829759
Genome map
AA seq 81 aa AA seqDB search
MSEATAHNPEDYKVGKGNILGGVENPYLEKSEWGWAIDPIGLRLVLDDFYYRYQLPLFIV
ENGPDGPTVEDDYRMITFKNT
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcaacagcacacaacccagaagactataaggttggtaaaggcaacatctta
ggtggtgtcgaaaatccataccttgagaaatctgaatggggctgggctattgatccaatt
ggacttcgtttggttttagatgacttttattatcgttatcaattgccattgtttattgtc
gaaaatggtcctgatggtccgacagttgaggatgattatcgtatgattactttcaaaaac
acttga

DBGET integrated database retrieval system