KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0885Help
Entry
Y1U_C0885         CDS       T02116                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Y1U_C0885
Enzymes [BR:stw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Y1U_C0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
856600..858081
Genome map
AA seq 493 aa AA seqDB search
MHITSLPGDYGIGSFGQAAYDFVDFLKETKQTYWQILPLTTTSYGDSPYQSFSAIAGNTH
FIDLDFLIRDGFLTEADVEGSDFGSDPEFIDYAKVYEARRPLLEKAVKAILADENEAKKF
ETFKAENANWLADYADFMAIKEYFGNKALQDWDDIKAIKRDEATLEKLRKELTGVITYHQ
VVQYLFFSQWAELKAYANKNGIQIIGDMPIYVSADSVEVWTQPHLFKLDAECKPRYIAGV
PPDNFSPTGQLWGNPIYDWDKHKAENYAWWVFRIQESFKLFDCLRIDHFKGFSDFWEIPA
GDETAENGKWVPGPGYDLFKVVKEELGDLKIIAEDLGNIDDKTRKLLADCGYPGMKILHF
GFYDTTGNSIYVPHAYTQHSVAYTGTHDNEVTNGWYNNLTQEQRDYTDAYINRRQGEPIT
RALLRTLFATVSNTAIATMQDILDKNENSRKNIPNTVGGNWRWRMLPGEITVDKKEFLTD
ITERYNRGNRGNK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcacatcacttccaggtgactacggaatcggatcttttggtcaagcagcctac
gactttgttgatttcttgaaagaaacaaagcaaacatactggcaaattttgccattgact
actacaagttatggagattcaccataccaatcattctcagcaatagcgggaaatactcac
tttatcgatttggatttccttattcgtgacggattcctgactgaagcagatgttgaaggt
tctgattttggttcagatccagagtttatcgactacgctaaagtttacgaagcacgacgc
ccacttcttgaaaaagcagtcaaagcaatcttggcagatgaaaacgaagctaagaagttt
gaaactttcaaagctgaaaatgctaactggttggcagattatgctgacttcatggctatc
aaagaatactttggtaacaaagcccttcaagattgggatgatataaaagcgattaaacgt
gatgaagcaactcttgaaaagcttcgcaaagaacttactggtgttatcacataccatcaa
gttgtgcaatacctcttctttagccaatgggcagagttgaaagcctatgctaataagaac
ggtattcaaattattggtgatatgccaatctacgtttcagctgatagtgtggaagtctgg
actcaaccacaccttttcaaattagatgctgaatgtaagccacgttacattgccggagtt
ccaccagataacttctcaccaacaggacaactttgggggaatccaatttatgattgggat
aaacacaaagcagaaaactatgcttggtgggtcttccgtattcaagaatcattcaaactt
tttgattgcttgcgtatcgaccacttcaaaggtttctctgatttctgggaaattcctgct
ggagatgaaactgctgaaaatggtaaatgggttccaggacctggttatgacctcttcaaa
gtggttaaagaagagttgggtgatcttaagattattgccgaagaccttggtaatattgat
gataaaacacgtaaacttcttgcagactgtggttacccaggaatgaagattcttcacttt
ggattctatgataccactggtaacagcatttatgttccacacgcatacacacaacactca
gtggcttacactggtacacatgataatgaagttactaatggttggtataataacttgaca
caagagcaacgtgattacactgatgcttatatcaaccgtcgtcaaggtgaaccaatcaca
cgtgcccttcttcgcacactcttcgcaacagtaagtaacacagctattgcgactatgcaa
gatattcttgataaaaatgaaaatagccgtaaaaacatccctaacacagttggaggaaac
tggagatggcgtatgcttccaggtgaaatcaccgtcgataagaaagaatttctgactgat
attacagaaagatataatcgaggaaatcgaggaaataaataa

DBGET integrated database retrieval system