KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0960Help
Entry
Y1U_C0960         CDS       T02116                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Y1U_C0960
Enzymes [BR:stw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Y1U_C0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(933853..934596)
Genome map
AA seq 247 aa AA seqDB search
MKILSIIYDGGSRIPGARFAPTKYYQEAMLYDRKDSDIITINLGNQDLFSIDLESLSRTI
AESKVQIALGGDHSVTYLLAKATVREGAYLIVLDAHLDYFKDFESVVKNWNFLSFLTDIF
EKIIIIGERNFEFPSSFDNKIIILSMEEYWLNKSRVLKKLDSYIDESKDIYLSIDIDVLD
PSVFDSVSYPIIGGFQMNDFLGIISKILCSDKVYFCDIVEYNPMVGSDNAHIFYQMIQFV
KSKLRRI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattatctattatttatgatggtggaagtagaattccaggagcgagatttgct
cccacaaaatattatcaagaagcgatgttatatgataggaaagattctgatataattaca
attaatttaggtaatcaagatttattttctattgatttagaaagtctaagtcgaactatt
gctgaatctaaagttcagattgctttaggaggagatcattcagttacttatctattagca
aaggccactgttcgagagggagcatatttaattgttttagatgctcatttagattacttc
aaagactttgaaagtgttgtaaaaaattggaattttttaagttttttaaccgatattttt
gaaaaaataattatcattggggaaaggaattttgagtttcctagttcatttgataataaa
ataatcatcctctcaatggaggagtattggttaaataagagtagagttttgaaaaagtta
gatagttatattgatgagtcaaaagatatttacttatcaatagacattgatgttttggat
ccatctgtttttgattcagtatcatatcctattattggaggatttcaaatgaacgatttt
cttggaataatttccaaaattttatgttctgataaggtatatttttgtgatatagttgag
tacaatccgatggttggaagtgataatgctcacattttttaccaaatgattcaatttgtt
aaatcaaaattaaggaggatatag

DBGET integrated database retrieval system