KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0988Help
Entry
Y1U_C0988         CDS       T02116                                 

Definition
(GenBank) Alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
stw00010  Glycolysis / Gluconeogenesis
stw00350  Tyrosine metabolism
stw00625  Chloroalkane and chloroalkene degradation
stw00626  Naphthalene degradation
stw01100  Metabolic pathways
stw01110  Biosynthesis of secondary metabolites
stw01120  Microbial metabolism in diverse environments
stw01130  Biosynthesis of antibiotics
stw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C0988
  Lipid metabolism
   00071 Fatty acid degradation
    Y1U_C0988
  Amino acid metabolism
   00350 Tyrosine metabolism
    Y1U_C0988
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Y1U_C0988
   00626 Naphthalene degradation
    Y1U_C0988
Enzymes [BR:stw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Y1U_C0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 TrkA_N Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AFJ83437
Position
complement(961585..962232)
Genome map
AA seq 215 aa AA seqDB search
MSDYALVTADYAVKVPDGLNPAQASSITCAGVTTYKAIKEAKVEPGQWVAIYGAGGLGNL
AIQYAKKVFNTRVVAVDINQDKLYLAKESGADLVVNGKEVEDVAGYIQEKTGGTHSAVVT
AVYKVAFNQAVDRVRAVGLPSEYMDLSIVKTVLDGIHVVGSLVGTRKDLEEAFDFGAQGL
VVTVVETVPVDTAVKVFDQMEKGKIQGRKVLDFTK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactatgctttggttactgctgactacgctgtgaaagttccagacggactcaat
cccgctcaagcttcatctattacttgtgcgggagttacaacttataaagccattaaagag
gctaaagttgaacctggtcaatgggtagctatttatggtgctggagggctaggtaatttg
gctattcaatatgctaagaaagtttttaacacacgagtagtagcagttgatatcaatcaa
gataaactatatttggctaaagaatctggcgctgatttagtggtaaatggtaaagaagtt
gaagatgtagcaggctatatccaagagaaaactggtggtacacacagtgctgttgtaaca
gctgtttataaggttgctttcaaccaggctgtcgatagagtacgtgccgttgggctccca
tctgaatacatggatctctcaattgtcaaaacagttctagatggtatccatgttgttgga
tctcttgtaggtacgcgtaaagacttagaagaagcttttgacttcggtgcacaaggcttg
gtagtaacagttgttgaaaccgttcctgtcgatacagctgtaaaagtatttgatcaaatg
gaaaaaggtaaaattcaaggacgtaaggtacttgatttcactaagtaa

DBGET integrated database retrieval system