KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0989Help
Entry
Y1U_C0989         CDS       T02116                                 

Definition
(RefSeq) alcohol dehydrogenase I
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Y1U_C0989
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C0989
  Lipid metabolism
   00071 Fatty acid degradation
    Y1U_C0989
  Amino acid metabolism
   00350 Tyrosine metabolism
    Y1U_C0989
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Y1U_C0989
   00626 Naphthalene degradation
    Y1U_C0989
Enzymes [BR:stw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Y1U_C0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(962352..962591)
Genome map
AA seq 79 aa AA seqDB search
MRAVVVNQASTGIEVVDYEKPALVAHGQALVKVEYCGVWHTDLHVAHGDFGQVPGHILGH
ERIGIVEEVGEGVKTLKKR
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttgttgttaatcaagcaagcacaggtattgaagttgtggactatgaaaaa
ccagcgttagttgctcatggtcaagccttggttaaagttgaatactgtggcgtttggcat
actgaccttcatgtagcccatggagactttggtcaagttccaggtcatatcttaggccat
gagagaattggtattgttgaagaagttggtgaaggggttaaaacactaaaaaaaaggtga

DBGET integrated database retrieval system