KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0989Help
Entry
Y1U_C0989         CDS       T02116                                 

Definition
alcohol dehydrogenase I
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:stw01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stw00010]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:stw00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:stw00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:stw00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(962352..962591)
Genome map
AA seq 79 aa AA seqDB search
MRAVVVNQASTGIEVVDYEKPALVAHGQALVKVEYCGVWHTDLHVAHGDFGQVPGHILGH
ERIGIVEEVGEGVKTLKKR
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttgttgttaatcaagcaagcacaggtattgaagttgtggactatgaaaaa
ccagcgttagttgctcatggtcaagccttggttaaagttgaatactgtggcgtttggcat
actgaccttcatgtagcccatggagactttggtcaagttccaggtcatatcttaggccat
gagagaattggtattgttgaagaagttggtgaaggggttaaaacactaaaaaaaaggtga

DBGET integrated database retrieval system