KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1100Help
Entry
Y1U_C1100         CDS       T02116                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Y1U_C1100
   01230 Biosynthesis of amino acids
    Y1U_C1100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C1100
   00030 Pentose phosphate pathway
    Y1U_C1100
   00051 Fructose and mannose metabolism
    Y1U_C1100
   00052 Galactose metabolism
    Y1U_C1100
  Energy metabolism
   00680 Methane metabolism
    Y1U_C1100
Enzymes [BR:stw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Y1U_C1100
Protein phosphatases and associated proteins [BR:stw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Y1U_C1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1069200..1070219)
Genome map
AA seq 339 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVLKAISEGIEVFGINRGYAGMVEGDIFKLDAKRVENI
LSRGGTFLQSARYPEFAQLEGQLKGIEQLKKYGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATATEALDKIQDTAFSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEYDINEVVRKVKEGYESGEKSHHIIVLAEGVMGAEEFAAKMKEAGD
TSDLRATNLGHVIRGGSPTARDRVLASWMGAHAVDLLKEGIGGVAVGIHNEQLVESPILG
TAEEGALFSLTEDGKIIVNNPHKARLDFAELNRSLANLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggagatgcccctggtatgaacgctgccgtt
cgtgcagttgttctcaaagcaatttctgaaggaattgaagtgttcggcattaaccgtgga
tacgccggtatggttgaaggagatatcttcaaacttgatgccaaacgcgtagaaaacatc
cttagccgtggtggcactttccttcagtctgctcgctatcccgagtttgcccaacttgaa
ggtcaacttaaaggtattgagcaacttaaaaaatatggaatcgaaggtgtagttgttatt
ggtggagatggttcttaccatggtgctatgcgtttgactgaacatggtttcccagcagtt
ggtctcccaggaactatcgataacgatatcgttggtacagactatacaattggatttgat
acagccgttgcaactgcaacagaagctttggataaaatccaagatacagctttcagtcat
ggacgtacttttgtcgttgaggtaatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcttcaggtgctgaccaaattattgtgccagaagaagaatatgacatcaacgaa
gtggttcgtaaagttaaagaaggttatgaatctggcgaaaaatctcaccacattattgtg
cttgctgagggcgttatgggtgctgaagagtttgcagctaaaatgaaagaagctggagat
acatcagaccttcgtgctacaaatcttggacacgtaattcgtggtggttcaccaactgca
cgtgaccgtgttcttgcttcatggatgggtgcacatgccgttgatcttcttaaagaagga
attggtggtgttgctgtcggtatccataatgaacagcttgttgaaagtccaatccttggt
acagcagaagaaggtgctttgttcagtcttactgaagacggtaaaattatcgtaaacaat
ccacacaaagctcgtcttgattttgcagagcttaaccgttctttagctaacttgaaataa

DBGET integrated database retrieval system