KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1307Help
Entry
Y1U_C1307         CDS       T02116                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
stw00010  Glycolysis / Gluconeogenesis
stw00052  Galactose metabolism
stw01100  Metabolic pathways
stw01110  Biosynthesis of secondary metabolites
stw01120  Microbial metabolism in diverse environments
stw01130  Biosynthesis of antibiotics
Module
stw_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C1307
   00052 Galactose metabolism
    Y1U_C1307
Enzymes [BR:stw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Y1U_C1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFJ83756
Position
complement(1271948..1272994)
Genome map
AA seq 348 aa AA seqDB search
MKISCEIIGKVDSGDVSKISMENNNGVVISTLTTGATLQEFLVPMETGALKNIVLGFSDF
EDYYKNNLCACQSIGRVAGRIGKASYTHNMVLYSLPKNEGDNCLHGGPKGMQVQNWNYVT
NLNDDYVETKFIRRLYSSVDGFPGDVTVSISYRLNNNNRLTILFEAFDVTESTVFNPTNH
VYFNLSDKQDLSSHELQIYSDYRLELDSELIPTGQKINVDETNYDFRKTTDLLPRIEANN
GFDDAFVVGGGTCDHVKEVAILHDKESGDGIEIFSNRNGLVIFTMDDIEDNIYFARDKGK
MAKRREAIAMEAQTLPDAVNHKGFGDIILDKGHSVNYEIGFQYFNSSR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagctgcgaaattattggaaaagttgattcaggcgatgtcagtaaaatttca
atggaaaataataatggtgttgtcatttccacactcacaacaggtgctacacttcaggag
tttttggttccaatggaaactggtgctcttaaaaatatagtacttggtttcagtgatttc
gaggattactataagaataatttatgtgcctgccagtccattggtagggttgctggaaga
attgggaaagcttcgtatactcataatatggttctttatagccttcctaagaatgaggga
gacaactgcttacatggcggtccaaaaggaatgcaggttcaaaattggaactatgtcaca
aacctgaatgatgattatgttgagacaaaatttattagaagactttattcaagtgtagat
ggctttcctggtgatgtgacagtctctattagttatagacttaacaataataaccgctta
acaatactctttgaagccttcgatgttacagagtcaacagtctttaatccgacaaaccat
gtttactttaatcttagcgacaaacaggatttatcaagtcatgagttacaaatctattca
gactatcgtttagagttggattctgagttaattccaacaggacaaaaaattaatgtagat
gaaacgaattatgattttagaaagacaactgacttgctacctcgaattgaagcaaataat
ggttttgatgatgcctttgtagttggagggggaacttgtgatcatgtgaaagaagtagct
attttgcatgacaaagaaagtggagatggtattgaaatcttctcaaacagaaatggttta
gtcatttttacgatggatgatatcgaagataatatttactttgcaagagataaaggcaaa
atggcaaaaaggcgtgaagctattgctatggaagctcaaacccttccagatgccgttaat
cacaaaggttttggagatattatcttagataaaggtcatagtgtaaactatgaaattggc
ttccaatactttaattcatcaagataa

DBGET integrated database retrieval system