KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1437Help
Entry
Y1U_C1437         CDS       T02116                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Y1U_C1437
Enzymes [BR:stw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Y1U_C1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1402426..1402989)
Genome map
AA seq 187 aa AA seqDB search
MENQEKVEQAVYQLLEALGENPEREGLLDTPKRVAKMYAEMFSGLNEDPKDQFTAVFSEV
HDEVVLVKDIPFYSMCEHHLVPFYGMAHVAYLPSGDKVTGLSKLARAVEVAARRPQLQER
LTDQVATALEEALNPRGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIYKEDREERKEI
LSLMRDF
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaagaaaaagtagaacaagcagtctatcaattattggaagctttgggtgag
aatcctgagcgtgaaggtcttttggatacgccaaaacgtgtggctaagatgtatgctgag
atgttttcaggtttaaatgaagacccgaaagatcagtttacagcggttttttcagaagtt
catgatgaagttgtacttgttaaggatattcctttttactctatgtgtgagcatcacttg
gttcctttttatggcatggctcatgtagcctatttgccaagtggggataaggtgacagga
ctatcaaaattggcacgtgctgttgaagtggcagcccgtcgtccacaattgcaagaacgt
ctcacagatcaagtcgctacagcgcttgaagaagcccttaatcctcgaggggtctttgtt
atggtggaagctgagcacatgtgtatgactatgcgtggtattaaaaaaccaggaagtaag
accatcacaacggttgctaaaggtatctataaagaagaccgtgaagaacgtaaggaaatt
ctttctttgatgcgtgatttttag

DBGET integrated database retrieval system