KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1484Help
Entry
Y1U_C1484         CDS       T02116                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Y1U_C1484
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Y1U_C1484
Enzymes [BR:stw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Y1U_C1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1449511..1450278)
Genome map
AA seq 255 aa AA seqDB search
MSKAFLPTILEQKEKEVAQLVMEDLQPLRQTYRLYDFLKSNQNKLQIISEVKKASPSMGD
INLDVDIVAQAKTYEENGAAMISVLTDEVFFKGDISYLKEISTQVAIPTLAKDFIIDEKQ
IVRSRNAGATVILLIVVALPEARLKELYDFATSLGLEVLVETHNLPELEVAHRIGAEIIG
VNNRNLVTFETDINTSLELSTHFKDKPVYISESAIFTGQDAALVAPYFNGILVGTALMTA
DNVAKKVKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcttttcttccaacaatcctagaacaaaaagaaaaagaagtggcccagttg
gtcatggaagacttacagcccttgcgtcagacctatcgcctttatgattttctcaagtca
aatcaaaacaagttgcaaattatttctgaagtgaagaaagccagtccaagtatgggtgat
attaacctagatgtggatattgtagctcaggccaagacctatgaggaaaatggggcagcc
atgatttcagttttgactgacgaagtcttcttcaaaggtgatatttcctatttgaaagaa
atttcgacacaggtagcgattccaaccttggctaaggacttcattattgatgagaaacag
attgtgcgtagccgtaatgcgggtgcgacagtcattctcttgattgtagtggccttgcca
gaagctcgtctcaaggagctctatgattttgcgactagccttggcttggaagtcttggtt
gaaacgcataatctgccagaattggaagtggctcaccgtattggtgctgaaattatcgga
gtaaacaaccgtaatttggtgacatttgagacagatatcaataccagtcttgagttatcg
acgcatttcaaggataaacctgtttatatttctgagtcggctatttttacaggtcaggat
gctgccctagttgccccatattttaatgggattctggtaggaactgcccttatgacggct
gacaatgtagctaaaaaggtcaaggagttgcaaattgacaaaggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system