KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1767Help
Entry
Y1U_C1767         CDS       T02116                                 

Definition
aldehyde-alcohol dehydrogenase 2
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Y1U_C1767
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C1767
   00620 Pyruvate metabolism
    Y1U_C1767
   00650 Butanoate metabolism
    Y1U_C1767
  Lipid metabolism
   00071 Fatty acid degradation
    Y1U_C1767
  Amino acid metabolism
   00350 Tyrosine metabolism
    Y1U_C1767
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Y1U_C1767
   00626 Naphthalene degradation
    Y1U_C1767
Enzymes [BR:stw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Y1U_C1767
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Y1U_C1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1724828..1725223)
Genome map
AA seq 131 aa AA seqDB search
MTKQTKDVQTVIDELATKGVEALDAMANFTQEQVDHIVHQAAIAALDKHMYLAKLAVDET
GRGIYEDKAIKNMYASEYIWNSIEYDKPVGVIAEDKEQGLVSIAEPVGVICGVTPTTNPT
STTIFKALIAL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaaactaaagatgttcaaacagtaatagatgaattggcaacaaaaggtgtt
gaagccctcgatgccatggctaactttacgcaggagcaagtggaccacattgttcaccaa
gctgcgattgctgctctagataaacatatgtatttggcaaaattggctgttgatgaaaca
ggccgtggtatttatgaagataaagccatcaaaaacatgtatgcttctgaatacatttgg
aatagtattgaatatgacaagccagtaggcgttatcgctgaagataaagaacaaggtttg
gtttctatcgctgagccagtaggcgttatctgtggggtgacaccaacaactaacccaacc
tcaacaacgattttcaaagcccttatcgctctttag

DBGET integrated database retrieval system