KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1767Help
Entry
Y1U_C1767         CDS       T02116                                 

Definition
(GenBank) Aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
stw00010  Glycolysis / Gluconeogenesis
stw00350  Tyrosine metabolism
stw00620  Pyruvate metabolism
stw00625  Chloroalkane and chloroalkene degradation
stw00626  Naphthalene degradation
stw00650  Butanoate metabolism
stw01100  Metabolic pathways
stw01110  Biosynthesis of secondary metabolites
stw01120  Microbial metabolism in diverse environments
stw01130  Biosynthesis of antibiotics
stw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C1767
   00620 Pyruvate metabolism
    Y1U_C1767
   00650 Butanoate metabolism
    Y1U_C1767
  Lipid metabolism
   00071 Fatty acid degradation
    Y1U_C1767
  Amino acid metabolism
   00350 Tyrosine metabolism
    Y1U_C1767
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Y1U_C1767
   00626 Naphthalene degradation
    Y1U_C1767
Enzymes [BR:stw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Y1U_C1767
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Y1U_C1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFJ84216
Position
complement(1724828..1725223)
Genome map
AA seq 131 aa AA seqDB search
MTKQTKDVQTVIDELATKGVEALDAMANFTQEQVDHIVHQAAIAALDKHMYLAKLAVDET
GRGIYEDKAIKNMYASEYIWNSIEYDKPVGVIAEDKEQGLVSIAEPVGVICGVTPTTNPT
STTIFKALIAL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaaactaaagatgttcaaacagtaatagatgaattggcaacaaaaggtgtt
gaagccctcgatgccatggctaactttacgcaggagcaagtggaccacattgttcaccaa
gctgcgattgctgctctagataaacatatgtatttggcaaaattggctgttgatgaaaca
ggccgtggtatttatgaagataaagccatcaaaaacatgtatgcttctgaatacatttgg
aatagtattgaatatgacaagccagtaggcgttatcgctgaagataaagaacaaggtttg
gtttctatcgctgagccagtaggcgttatctgtggggtgacaccaacaactaacccaacc
tcaacaacgattttcaaagcccttatcgctctttag

DBGET integrated database retrieval system