KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_0501Help
Entry
MGAS1882_0501     CDS       T02062                                 

Gene name
bglB.1
Definition
6-phospho-beta-glucosidase protein BglB
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stx00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466505..467929
Genome map
AA seq 474 aa AA seqDB search
MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWTDSPTSDNLTLEAIDF
YHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQFYDDLFDELLNYGIEPL
VTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKVKYWLTFNEVNSILHMPF
TSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDVKVGCMILAMPAYPMTSDP
RDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIVFEDGDKELLAEHTVDFLSF
SYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQIDPIGLRLVLNQYYDRYQIPL
FIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQVAKAIEDGVEVMGYTAWGCIDC
VSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWYRQVIQTNGRYLEDNFS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggaatttttccaaaagatttcttatggggcggcgcagtagctgccaaccaagtggaa
ggagcatttgaggcagacgcaaaaggtttgtccgtacaagatgttctaccaaatggtgga
ctaggagaatggacagatagtcctaccagcgataatttaactttagaggcgattgatttt
taccaccgctacaaagaagacattgctctttttgccgagatgggctttaaagtctttcga
acgtctattgcttggtctcgtatttttccaaatggtgacgatgaccagcccaatgaagca
ggtttgcaattttatgatgacttattcgatgaattgttgaactatggtatcgaaccctta
gtgaccttgtcgcattatgagacacctctgcatttggccaaagcctataatggttggaca
gatagacgtctgattggcttttttgagcgctttgctcagacagtcatggaacgctataag
gacaaagtcaaatactggttgaccttcaacgaagtcaactcgattttacacatgcccttt
accagtggtggcatcatgacagaaaaagaaaagctgagcctgcaagatttataccaagct
attcatcatgaattggtagcatctgctagtgtcacaaagctagcgcatgaaatcaatcct
gatgttaaagttgggtgtatgattttggcgatgcctgcttacccaatgacctctgatcct
cgtgatatacttgctgcgcatgcatttgaaaatcttaatctcttattttcagatattcat
gtgagaggcaagtatccttcatatattaagtcgtattttaaagaaaatgggattgagatt
gtttttgaagacggagacaaggaattattagcggaacatacggttgattttctatccttt
agctattacatgagtgtcacacaagcccacaatcctgaagcttacacatctggtcaggga
aatattctaggtggtttgtccaatccatatttagaatcttcggagtggggttggcagata
gacccaattggtctgcgattggtcttgaatcagtactatgaccgctaccagattcctttg
tttattgttgaaaatggcttaggtgcaaaggatcagctggtgcaaaccgcagatggcagc
atgacggttcacgatgattatcgcattgactacatgagtcagcatctcgtacaagttgcc
aaagcgattgaagatggcgttgaggtcatgggttacactgcttggggctgtattgattgt
gtctctatgtcaacagcccaattaagtaagcgctacggttttatttatgttgaccgaaat
gatgatggtactggtcaactcacacgctataagaaaaaatcatttgattggtaccgacaa
gtcattcaaaccaatggacgttaccttgaggataatttttcctaa

DBGET integrated database retrieval system