KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_0526Help
Entry
MGAS1882_0526     CDS       T02062                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:stx00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:stx00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(486986..487465)
Genome map
AA seq 159 aa AA seqDB search
MPNLYDFTVKAQNGNDLSLAAYKKKVVLIVNTATKCGLTPQYQALQVLYDTYHDKGFEVL
DFPCNQFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDADPLFAWLKEEKSGPLGK
RIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatctctatgattttacggttaaggctcaaaacgggaatgacctttccttagct
gcttataaaaaaaaggttgttttgattgttaacacagctaccaagtgtggattaacccca
caataccaggccttgcaagtactatatgacacataccatgacaagggatttgaggtctta
gattttccttgcaaccaatttttaaatcaagctccaggagatgctgaggagattaatcac
ttttgcagtctgacctatcacactactttccctcgctttgcaaaaatcaaagtgaatggt
aaagacgctgatcctttgtttgcctggttaaaagaagaaaaaagtggtccccttgggaaa
cgcatcgaatggaatttcactaaatttctcattgaccaaaatggtcaagtcattaaacgc
tattcctcaaagacagatcctaaactaattgaagaagaccttaaagcacttcttggttaa

DBGET integrated database retrieval system